StarFunc result for job id O75509

User Input

>input (655 residues)
MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEK
LPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSPGTAIFPRPEHMETHE
VPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLL
VLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEP
SPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75509	1.000	1.000	0.000	655	1.000	1.000	O75509.pdb.gz	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
2	AFDB:D3ZF92	0.492	0.492	2.625E-96	655	0.885	0.885	D3ZF92.pdb.gz	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
3	AFDB:A5D8S6	0.442	0.453	1.709E-68	637	0.533	0.548	A5D8S6.pdb.gz	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
4	AFDB:O95407	0.242	0.503	3.324E-18	300	0.098	0.213	O95407.pdb.gz	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
5	AFDB:O08712	0.233	0.366	6.252E-18	401	0.089	0.145	O08712.pdb.gz	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
6	AFDB:O00300	0.234	0.369	1.660E-17	401	0.085	0.140	O00300.pdb.gz	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
7	AFDB:O75475	0.070	0.080	5.470E-3	530	0.092	0.113	O75475.pdb.gz	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
8	AFDB:A0A3B3ISP1	0.067	0.044	1.725E-2	1194	0.140	0.077	A0A3B3ISP1.pdb.gz	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
9	AFDB:Q3TGQ4	0.064	0.053	2.171E-2	858	0.144	0.110	Q3TGQ4.pdb.gz	Q3TGQ4_MOUSE Ribosomal protein eL8/eL30/eS12/Gadd45 domain-containing protein OS=Mus musculus OX=10090 GN=Secisbp2 PE=2 SV=1
10	PDB:6mksA	0.104	0.640	2.494E-2	90	0.027	0.200	6mksA.pdb.gz
11	AFDB:Q8NDZ0	0.071	0.064	2.732E-2	799	0.139	0.114	Q8NDZ0.pdb.gz	BEND2_HUMAN BEN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BEND2 PE=1 SV=2
12	PDB:1dgnA	0.105	0.668	2.481E-1	89	0.015	0.112	1dgnA.pdb.gz
13	PDB:2kn6A	0.098	0.297	2.481E-1	195	0.041	0.138	2kn6A.pdb.gz
14	PDB:6ki0A	0.104	0.145	2.481E-1	459	0.017	0.024	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
15	PDB:7o4i1	0.054	0.062	5.236E-1	522	0.038	0.048	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:5juyB	0.099	0.054	6.220E-1	1234	0.017	0.009	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
17	PDB:7q3nU	0.082	0.121	6.588E-1	292	0.046	0.103	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:6hivBI	0.069	0.122	1.170	319	0.031	0.063	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:1ykbD	0.059	0.149	1.239	142	0.027	0.127	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
20	PDB:3duhC	0.047	0.168	1.559	137	0.012	0.058	3duhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5D8S6	0.0	640	637	0.537	0.553	A5D8S6_DANRE Tnfrsf21 protein OS=Danio rerio OX=7955 GN=wu:fc29a09 PE=2 SV=1
2	D3ZF92	0.0	1077	655	0.892	0.892	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
3	O75509	0.0	1357	655	1.000	1.000	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
4	Q9EPU5	0.0	1089	655	0.890	0.890	TNR21_MOUSE Tumor necrosis factor receptor superfamily member 21 OS=Mus musculus OX=10090 GN=Tnfrsf21 PE=1 SV=2
5	O00300	1.22e-23	105	401	0.108	0.177	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
6	O08727	3.58e-23	104	401	0.089	0.145	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
7	O08712	2.95e-22	101	401	0.137	0.224	TR11B_MOUSE Tumor necrosis factor receptor superfamily member 11B OS=Mus musculus OX=10090 GN=Tnfrsf11b PE=1 SV=1
8	O95407	1.12e-21	98.2	300	0.089	0.193	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
9	P20333	1.50e-20	97.4	461	0.101	0.143	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
10	F6SVZ3	1.43e-17	85.5	269	0.085	0.208	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
11	A0A8I6AHI1	9.51e-17	84.0	309	0.085	0.181	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
12	Q8UYL3	3.25e-16	79.0	167	0.082	0.323	Q8UYL3_9POXV CrmE protein OS=Vaccinia virus OX=10245 GN=crmE PE=1 SV=1
13	Q80WM9	7.89e-16	80.5	275	0.095	0.225	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
14	Q71F55	8.02e-16	80.5	276	0.095	0.225	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
15	A0A8I6A4J5	1.73e-15	79.0	260	0.082	0.208	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
16	P25119	6.46e-15	80.1	474	0.078	0.108	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
17	P27512	5.12e-14	75.5	289	0.079	0.180	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
18	P36941	4.53e-13	73.9	435	0.075	0.113	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
19	F1RAS9	2.36e-12	71.6	425	0.081	0.125	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
20	Q80WY6	3.15e-12	71.6	474	0.098	0.135	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	40	15.6	Caspase recruitment domain
2	PF00531 Death	1.5e-09	49.2	Death domain
3	PF07699 Ephrin_rec_like	0.52	21.4	Tyrosine-protein kinase ephrin type A/B receptor-like
4	PF10192 GpcrRhopsn4	7.5e+02	10.9	Rhodopsin-like GPCR transmembrane domain
5	PF00020 TNFR_c6	3e-16	70.9	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.996	Amyloid-beta A4 protein
2	9606.ENSP00000341268	0.920	Tumor necrosis factor receptor type 1-associated DEATH domain protein
3	9606.ENSP00000367013	0.909	Tumor necrosis factor receptor superfamily member 25
4	9606.ENSP00000419692	0.906	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000385523	0.904	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000262367	0.903	CREB-binding protein
7	9606.ENSP00000217964	0.901	F-box-like/WD repeat-containing protein TBL1X
8	9606.ENSP00000260129	0.900	Trimethylguanosine synthase
9	9606.ENSP00000262188	0.900	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000300651	0.900	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000325690	0.900	Histone-arginine methyltransferase CARM1
12	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
13	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1
14	9606.ENSP00000399968	0.900	Nuclear receptor coactivator 2
15	9606.ENSP00000405574	0.900	F-box-like/WD repeat-containing protein TBL1XR1
16	9606.ENSP00000417401	0.900	Helicase with zinc finger domain 2
17	9606.ENSP00000457466	0.900	Chromodomain-helicase-DNA-binding protein 9
18	9606.ENSP00000371693	0.839	Tumor necrosis factor receptor superfamily member 19
19	9606.ENSP00000172229	0.788	Tumor necrosis factor receptor superfamily member 16
20	9606.ENSP00000221132	0.778	Tumor necrosis factor receptor superfamily member 10A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.655	signaling receptor activity
GO:0019899	0.500	enzyme binding
GO:0042802	0.384	identical protein binding
GO:0005102	0.376	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0048856	0.975	anatomical structure development
GO:0032501	0.974	multicellular organismal process
GO:0051716	0.968	cellular response to stimulus
GO:0008219	0.957	cell death
GO:0048519	0.946	negative regulation of biological process
GO:0007275	0.935	multicellular organism development
GO:0006915	0.930	apoptotic process
GO:0051241	0.895	negative regulation of multicellular organismal process
GO:0048523	0.895	negative regulation of cellular process
GO:0048518	0.890	positive regulation of biological process
GO:0048731	0.842	system development
GO:0050793	0.839	regulation of developmental process
GO:0007399	0.826	nervous system development
GO:0048522	0.823	positive regulation of cellular process
GO:0019222	0.808	regulation of metabolic process
GO:0042221	0.800	response to chemical
GO:0060255	0.777	regulation of macromolecule metabolic process
GO:0010033	0.738	response to organic substance
GO:0007154	0.725	cell communication
GO:0007165	0.699	signal transduction
GO:0045595	0.672	regulation of cell differentiation
GO:0030154	0.658	cell differentiation
GO:0034097	0.652	response to cytokine
GO:0048583	0.531	regulation of response to stimulus
GO:0080090	0.528	regulation of primary metabolic process
GO:0051171	0.528	regulation of nitrogen compound metabolic process
GO:0070887	0.490	cellular response to chemical stimulus
GO:0071840	0.483	cellular component organization or biogenesis
GO:2000026	0.481	regulation of multicellular organismal development
GO:0010468	0.474	regulation of gene expression
GO:0048468	0.459	cell development
GO:0009893	0.458	positive regulation of metabolic process
GO:0031641	0.450	regulation of myelination
GO:0016043	0.443	cellular component organization
GO:0048584	0.421	positive regulation of response to stimulus
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0022008	0.381	neurogenesis
GO:0031323	0.362	regulation of cellular metabolic process
GO:0009966	0.345	regulation of signal transduction
GO:0065009	0.336	regulation of molecular function
GO:0010941	0.330	regulation of cell death
GO:0043067	0.310	regulation of programmed cell death
GO:0071310	0.304	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0043229	0.714	intracellular organelle
GO:0043231	0.617	intracellular membrane-bounded organelle
GO:0070013	0.525	intracellular organelle lumen
GO:0005829	0.428	cytosol
GO:0005634	0.378	nucleus
GO:0042995	0.300	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]