StarFunc result for job id O75525

User Input

>input (346 residues)
MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75525	1.000	1.000	1.086E-54	346	1.000	1.000	O75525.pdb.gz	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
2	AFDB:Q6NW62	0.491	0.484	2.784E-33	352	0.535	0.526	Q6NW62.pdb.gz	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
3	AFDB:Q07666	0.462	0.370	3.393E-32	443	0.595	0.465	Q07666.pdb.gz	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
4	AFDB:Q8UUW7	0.517	0.418	4.850E-32	433	0.578	0.462	Q8UUW7.pdb.gz	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
5	AFDB:A0A0R4ISK8	0.440	0.391	2.614E-27	395	0.462	0.405	A0A0R4ISK8.pdb.gz
6	AFDB:O44435	0.393	0.345	7.182E-24	396	0.329	0.288	O44435.pdb.gz	O44435_DROME QKR58E-1 OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=2 SV=1
7	AFDB:Q7KNS5	0.412	0.337	3.804E-23	428	0.382	0.308	Q7KNS5.pdb.gz	Q7KNS5_DROME Quaking related 54B, isoform A OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
8	AFDB:Q8T8U7	0.416	0.517	3.578E-20	275	0.251	0.316	Q8T8U7.pdb.gz	Q8T8U7_DROME AT29209p OS=Drosophila melanogaster OX=7227 GN=CG3927 PE=2 SV=1
9	AFDB:Q6P104	0.380	0.410	5.114E-20	319	0.306	0.332	Q6P104.pdb.gz	QKIB_DANRE Protein quaking-B OS=Danio rerio OX=7955 GN=qki2 PE=2 SV=1
10	AFDB:Q9W224	0.411	0.418	1.585E-19	340	0.246	0.250	Q9W224.pdb.gz	Q9W224_DROME Novel spermatogenesis regulator, isoform A OS=Drosophila melanogaster OX=7227 GN=nsr PE=4 SV=2
11	PDB:6ke6RC	0.181	0.218	2.056E-2	278	0.084	0.104	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
12	PDB:7mqaSW	0.187	0.313	7.178E-2	195	0.029	0.051	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6zqbJO	0.182	0.255	8.582E-2	236	0.069	0.102	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
14	PDB:7mq8NY	0.190	0.234	2.225E-1	274	0.040	0.051	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7ajuJJ	0.188	0.305	2.660E-1	199	0.061	0.106	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:3bh6B	0.136	0.147	5.434E-1	314	0.049	0.054	3bh6B.pdb.gz	The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
17	PDB:1z9cC	0.101	0.196	6.895E-1	138	0.072	0.181	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
18	PDB:7nshBC	0.120	0.066	9.855E-1	700	0.052	0.026	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
19	PDB:3j4sA	0.106	0.093	1.110	414	0.061	0.051	3j4sA.pdb.gz	Bacterial tubulin TubZ-Bt transitions between a two-stranded intermediate and a four-stranded filament upon GTP hydrolysis.
20	PDB:5ekzA	0.070	0.097	1.178	221	0.061	0.095	5ekzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5RJZ9	0.0	533	265	0.763	0.996	E5RJZ9_HUMAN KH RNA binding domain containing, signal transduction associated 3 (Fragment) OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
2	O75525	0.0	703	346	1.000	1.000	KHDR3_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
3	Q9JLP1	0.0	648	346	0.960	0.960	KHDR3_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Khdrbs3 PE=1 SV=1
4	Q9R226	0.0	684	346	0.971	0.971	KHDR3_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus OX=10090 GN=Khdrbs3 PE=1 SV=1
5	Q5VWX1	1.70e-148	424	349	0.653	0.648	KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1
6	Q9WU01	7.69e-147	420	349	0.650	0.645	KHDR2_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus OX=10090 GN=Khdrbs2 PE=1 SV=1
7	Q920F3	8.39e-140	402	349	0.650	0.645	KHDR2_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Khdrbs2 PE=1 SV=1
8	H0YAQ1	1.95e-129	370	195	0.532	0.944	H0YAQ1_HUMAN KH RNA binding domain containing, signal transduction associated 3 (Fragment) OS=Homo sapiens OX=9606 GN=KHDRBS3 PE=1 SV=1
9	Q91V33	4.47e-117	347	443	0.575	0.449	KHDR1_RAT KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1
10	Q60749	8.58e-117	347	443	0.575	0.449	KHDR1_MOUSE KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Mus musculus OX=10090 GN=Khdrbs1 PE=1 SV=2
11	Q07666	1.96e-113	338	443	0.561	0.438	KHDR1_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1
12	Q8UUW7	1.22e-106	320	433	0.558	0.446	KHDR1_CHICK KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Gallus gallus OX=9031 GN=KHDRBS1 PE=2 SV=1
13	Q6NW62	2.37e-98	296	352	0.500	0.491	Q6NW62_DANRE KH domain-containing, RNA-binding, signal transduction-associated 1b OS=Danio rerio OX=7955 GN=sb:cb97 PE=1 SV=1
14	Q6NW56	5.43e-83	258	370	0.491	0.459	Q6NW56_DANRE KH domain containing, RNA binding, signal transduction associated 1 OS=Danio rerio OX=7955 GN=khdrbs1 PE=1 SV=1
15	A2CE73	2.22e-81	254	369	0.491	0.461	A2CE73_DANRE KH domain containing, RNA binding, signal transduction associated 1a isoform X1 OS=Danio rerio OX=7955 GN=fj90g10 PE=1 SV=1
16	Q7KNS5	2.88e-63	209	428	0.384	0.311	Q7KNS5_DROME Quaking related 54B, isoform A OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
17	O44433	7.44e-62	205	425	0.384	0.313	O44433_DROME QKR54B OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=2 SV=1
18	A0A0B4KFT9	7.73e-62	209	617	0.384	0.216	A0A0B4KFT9_DROME Quaking related 54B, isoform E OS=Drosophila melanogaster OX=7227 GN=qkr54B PE=1 SV=1
19	A0A0B4LG88	9.95e-54	182	379	0.257	0.235	A0A0B4LG88_DROME Quaking related 58E-1, isoform D OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1
20	Q9W255	1.28e-53	183	396	0.257	0.225	Q9W255_DROME GH05812p OS=Drosophila melanogaster OX=7227 GN=qkr58E-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	0.0042	28.2	KH domain
2	PF16274 Qua1	3.8e-25	98.8	Qua1 domain
3	PF16568 Sam68-YY	2.6e-17	74.6	Tyrosine-rich domain of Sam68
4	PF16544 STAR_dimer	47	14.9	Homodimerisation region of STAR domain protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362808.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352171.1	0.872	KH domain-containing, RNA-binding, signal transduction-associated protein 1
2	61622.XP_010352986.1	0.809	RAS p21 protein activator 1
3	61622.XP_010355522.1	0.791	KH domain-containing, RNA-binding, signal transduction-associated protein 2
4	61622.XP_010363529.1	0.783	Protein-tyrosine kinase 6
5	61622.XP_010369868.1	0.772	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons
6	61622.XP_010382313.1	0.772	Heterogeneous nuclear ribonucleoprotein K isoform X1
7	61622.XP_010370700.1	0.771	Necessary for the splicing of pre-mRNA.
8	61622.XP_010377524.1	0.771	U2 small nuclear RNA auxiliary factor 2
9	61622.XP_010383686.1	0.770	pre-mRNA processing factor 40 homolog B
10	61622.XP_010354132.1	0.688	RNA-binding protein 25
11	61622.XP_010356461.1	0.663	Pyridoxamine 5'-phosphate oxidase
12	61622.XP_010359248.1	0.663	Far upstream element-binding protein 3 isoform X1
13	61622.XP_010354295.1	0.662	Polypyrimidine tract-binding protein 2
14	61622.XP_010363856.1	0.659	YTH domain containing 1
15	61622.XP_010353661.1	0.642	Proto-oncogene tyrosine-protein kinase Src
16	61622.XP_010387103.1	0.640	Belongs to the serpin family.
17	61622.XP_010353207.1	0.638	YES proto-oncogene 1, Src family tyrosine kinase
18	61622.XP_010356455.1	0.638	Fyn related Src family tyrosine kinase
19	61622.XP_010369949.1	0.638	Tyrosine-protein kinase Fyn isoform X1
20	61622.XP_010351350.1	0.621	Transformer-2 protein homolog alpha isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0042802	0.975	identical protein binding
GO:0019904	0.972	protein domain specific binding
GO:0003727	0.725	single-stranded RNA binding
GO:0003729	0.313	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050684	0.996	regulation of mRNA processing
GO:0043484	0.996	regulation of RNA splicing
GO:0048024	0.979	regulation of mRNA splicing, via spliceosome
GO:0009987	0.875	cellular process
GO:0071704	0.533	organic substance metabolic process
GO:0044238	0.474	primary metabolic process
GO:0006807	0.440	nitrogen compound metabolic process
GO:0044237	0.433	cellular metabolic process
GO:0043170	0.425	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.536	protein-containing complex
GO:0005737	0.481	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]