StarFunc result for job id O75528

User Input

>input (432 residues)
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRR
LRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGR
PKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPP
EDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL
LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPR
NQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHN
RTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTL
KERESILKLLDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75528	1.000	1.000	2.028E-59	432	1.000	1.000	O75528.pdb.gz	TADA3_HUMAN Transcriptional adapter 3 OS=Homo sapiens OX=9606 GN=TADA3 PE=1 SV=1
2	AFDB:Q9VWZ1	0.354	0.285	4.705E-17	556	0.296	0.230	Q9VWZ1.pdb.gz	Q9VWZ1_DROME Diskette OS=Drosophila melanogaster OX=7227 GN=Ada3 PE=1 SV=1
3	AFDB:Q8N6Y0	0.110	0.078	3.089E-2	703	0.134	0.083	Q8N6Y0.pdb.gz	USBP1_HUMAN Harmonin-binding protein USHBP1 OS=Homo sapiens OX=9606 GN=USHBP1 PE=1 SV=1
4	AFDB:Q15025	0.098	0.075	5.048E-2	636	0.190	0.129	Q15025.pdb.gz	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
5	AFDB:Q9JIR0	0.089	0.027	5.630E-2	1847	0.171	0.040	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
6	AFDB:F4K9W2	0.229	0.091	2.204E-1	1154	0.141	0.053	F4K9W2.pdb.gz	F4K9W2_ARATH Spectrin beta chain, brain OS=Arabidopsis thaliana OX=3702 GN=MWD9.25 PE=1 SV=1
7	AFDB:Q7X9H5	0.088	0.108	3.230E-1	334	0.090	0.117	Q7X9H5.pdb.gz	Q7X9H5_ARATH MADS-box protein OS=Arabidopsis thaliana OX=3702 GN=AGL84 PE=1 SV=1
8	AFDB:O60096	0.077	0.101	3.411E-1	315	0.095	0.130	O60096.pdb.gz	RT35_SCHPO Small ribosomal subunit protein mS45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bot1 PE=2 SV=1
9	AFDB:Q9C517	0.099	0.145	3.411E-1	282	0.120	0.184	Q9C517.pdb.gz	STKLE_ARATH Probable transcription factor At1g66420 OS=Arabidopsis thaliana OX=3702 GN=At1g66420 PE=1 SV=1
10	AFDB:A2A266	0.085	0.027	3.805E-1	1736	0.162	0.040	A2A266.pdb.gz	A2A266_CAEEL CEntrosomal Protein OS=Caenorhabditis elegans OX=6239 GN=ccep-290 PE=1 SV=1
11	PDB:7ungA3	0.189	0.230	8.062E-1	333	0.088	0.114	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:6v8oO	0.076	0.084	2.679	384	0.088	0.099	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
13	PDB:7rroA3	0.182	0.221	3.156	334	0.074	0.096	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7vkkA	0.052	0.071	3.156	287	0.053	0.080	7vkkA.pdb.gz
15	PDB:6iczL	0.152	0.145	3.333	454	0.125	0.119	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:6gxnv	0.116	0.140	5.448	348	0.042	0.052	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
17	PDB:6u424R	0.133	0.155	5.753	366	0.160	0.189	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
18	PDB:5afqB	0.089	0.087	6.417	444	0.060	0.059	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
19	PDB:4i9qB	0.115	0.058	6.777	873	0.014	0.007	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
20	PDB:4q4aA	0.114	0.087	6.777	572	0.019	0.014	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75528	0.0	874	432	1.000	1.000	TADA3_HUMAN Transcriptional adapter 3 OS=Homo sapiens OX=9606 GN=TADA3 PE=1 SV=1
2	Q4V8F5	0.0	865	432	0.986	0.986	TADA3_RAT Transcriptional adapter 3 OS=Rattus norvegicus OX=10116 GN=Tada3 PE=2 SV=1
3	Q8R0L9	0.0	870	432	0.993	0.993	TADA3_MOUSE Transcriptional adapter 3 OS=Mus musculus OX=10090 GN=Tada3 PE=1 SV=1
4	Q9VWZ1	1.10e-36	143	556	0.317	0.246	Q9VWZ1_DROME Diskette OS=Drosophila melanogaster OX=7227 GN=Ada3 PE=1 SV=1
5	M9PHZ1	1.95e-36	142	588	0.317	0.233	M9PHZ1_DROME Transcriptional adaptor 3, isoform C OS=Drosophila melanogaster OX=7227 GN=Ada3 PE=1 SV=1
6	Q5BG90	1.44e-07	56.2	659	0.162	0.106	Q5BG90_EMENI Transcriptional regulator Ngg1, putative (AFU_orthologue AFUA_1G04590) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00440 PE=3 SV=1
7	Q9USU8	5.09e-06	51.2	551	0.171	0.134	NGG1_SCHPO Chromatin-remodeling complexes subunit ngg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ngg1 PE=1 SV=1
8	P32494	0.060	38.1	702	0.067	0.041	NGG1_YEAST Chromatin-remodeling complexes subunit NGG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NGG1 PE=1 SV=1
9	Q9VCH1	4.3	32.3	2072	0.037	0.008	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
10	F1QXF5	5.4	32.0	1996	0.065	0.014	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
11	P34427	9.0	31.2	962	0.065	0.029	LIN36_CAEEL Protein lin-36 OS=Caenorhabditis elegans OX=6239 GN=lin-36 PE=1 SV=2
12	Q8I493	9.1	30.8	309	0.025	0.036	Q8I493_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500500 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10198 Ada3	5e-23	93.1	Histone acetyltransferases subunit 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008853071.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008846309.1	0.998	Transcriptional adaptor 2A
2	1026970.XP_008822151.1	0.997	SAGA-associated factor 29 homolog
3	1026970.XP_008852034.1	0.995	Transcriptional adaptor 2B
4	1026970.XP_008822250.1	0.994	Transformation/transcription domain-associated protein isoform X1
5	1026970.XP_008827251.1	0.994	SPT3 homolog, SAGA and STAGA complex component
6	1026970.XP_008833507.1	0.994	Histone acetyltransferase KAT2A isoform X1
7	1026970.XP_008845348.1	0.993	SPT20 homolog, SAGA complex component
8	1026970.XP_008831385.1	0.992	Histone acetyltransferase KAT2B
9	1026970.XP_008835639.1	0.992	TATA-box binding protein associated factor 10
10	1026970.XP_008848500.1	0.991	Lysine acetyltransferase 14
11	1026970.XP_008836386.1	0.990	Ataxin 7 like 3
12	1026970.XP_008846460.1	0.989	Transcriptional adapter 1 isoform X1
13	1026970.XP_008828886.1	0.986	YEATS domain containing 2
14	1026970.XP_008837070.1	0.986	TATA-box binding protein associated factor 9
15	1026970.XP_008835881.1	0.984	TATA-box binding protein associated factor 9b
16	1026970.XP_008843901.1	0.983	TATA-box binding protein associated factor 5
17	1026970.XP_008843999.1	0.981	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
18	1026970.XP_008835724.1	0.979	TATA-box binding protein associated factor 6 like
19	1026970.XP_008849718.1	0.977	Transcription and mRNA export factor ENY2 isoform X1
20	1026970.XP_008836859.1	0.974	Transcription initiation factor TFIID subunit 12-like isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0140297	0.954	DNA-binding transcription factor binding
GO:0061629	0.939	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.924	nuclear receptor binding
GO:0019904	0.883	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0044238	0.982	primary metabolic process
GO:0031056	0.977	regulation of histone modification
GO:0051302	0.976	regulation of cell division
GO:0010468	0.975	regulation of gene expression
GO:0090311	0.974	regulation of protein deacetylation
GO:0006807	0.973	nitrogen compound metabolic process
GO:0031323	0.973	regulation of cellular metabolic process
GO:0009889	0.966	regulation of biosynthetic process
GO:0010604	0.961	positive regulation of macromolecule metabolic process
GO:0043412	0.955	macromolecule modification
GO:0019538	0.955	protein metabolic process
GO:0048522	0.953	positive regulation of cellular process
GO:0031063	0.951	regulation of histone deacetylation
GO:0018193	0.948	peptidyl-amino acid modification
GO:0051726	0.940	regulation of cell cycle
GO:0016573	0.935	histone acetylation
GO:0031326	0.928	regulation of cellular biosynthetic process
GO:0019219	0.926	regulation of nucleobase-containing compound metabolic process
GO:0006508	0.907	proteolysis
GO:0006355	0.905	regulation of DNA-templated transcription
GO:0051173	0.899	positive regulation of nitrogen compound metabolic process
GO:0031325	0.898	positive regulation of cellular metabolic process
GO:0050896	0.893	response to stimulus
GO:0043966	0.882	histone H3 acetylation
GO:0006357	0.870	regulation of transcription by RNA polymerase II
GO:0045935	0.864	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.858	positive regulation of cellular biosynthetic process
GO:0010557	0.809	positive regulation of macromolecule biosynthetic process
GO:0051254	0.803	positive regulation of RNA metabolic process
GO:0045893	0.775	positive regulation of DNA-templated transcription
GO:0051716	0.763	cellular response to stimulus
GO:0070646	0.747	protein modification by small protein removal
GO:0016579	0.744	protein deubiquitination
GO:0016578	0.731	histone deubiquitination
GO:0042221	0.688	response to chemical
GO:0030522	0.672	intracellular receptor signaling pathway
GO:0048545	0.551	response to steroid hormone
GO:0009755	0.550	hormone-mediated signaling pathway
GO:0043401	0.541	steroid hormone mediated signaling pathway
GO:0030518	0.438	intracellular steroid hormone receptor signaling pathway
GO:0065008	0.325	regulation of biological quality
GO:0031647	0.323	regulation of protein stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0070461	0.996	SAGA-type complex
GO:0005654	0.985	nucleoplasm
GO:1905368	0.981	peptidase complex
GO:0000124	0.969	SAGA complex
GO:0140513	0.931	nuclear protein-containing complex
GO:0140672	0.917	ATAC complex
GO:0005737	0.715	cytoplasm
GO:0033276	0.391	transcription factor TFTC complex
GO:0005856	0.302	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]