StarFunc result for job id O75529

User Input

>input (589 residues)
MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSA
APCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFY
SRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQ
SDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALE
VLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSK
KLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSC
SEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLR
IYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNG
KYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIR
NTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75529	1.000	1.000	0.000	589	1.000	1.000	O75529.pdb.gz	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1
2	PDB:7ktrB	0.528	0.582	8.730E-88	534	0.905	0.998	7ktrB.pdb.gz	Structure of the human SAGA coactivator complex.
3	AFDB:P49846	0.511	0.429	1.249E-49	704	0.316	0.264	P49846.pdb.gz	TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1
4	AFDB:Q8C092	0.495	0.368	5.598E-49	801	0.367	0.270	Q8C092.pdb.gz	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
5	PDB:7egeE	0.512	0.551	3.701E-48	547	0.362	0.389	7egeE.pdb.gz
6	AFDB:P38129	0.515	0.385	2.737E-47	798	0.340	0.251	P38129.pdb.gz	TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF5 PE=1 SV=1
7	AFDB:Q6S7B0	0.482	0.426	4.514E-47	669	0.324	0.286	Q6S7B0.pdb.gz	TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana OX=3702 GN=TAF5 PE=1 SV=1
8	AFDB:Q9VCN9	0.499	0.400	4.924E-46	743	0.272	0.215	Q9VCN9.pdb.gz	Q9VCN9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=wda PE=2 SV=1
9	AFDB:O13282	0.498	0.457	1.672E-45	643	0.311	0.285	O13282.pdb.gz	TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf5 PE=1 SV=1
10	PDB:6t9iD	0.515	0.535	1.868E-45	566	0.304	0.316	6t9iD.pdb.gz
11	AFDB:O74319	0.479	0.440	6.045E-43	642	0.278	0.255	O74319.pdb.gz	TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1
12	AFDB:G5EF68	0.488	0.445	7.603E-41	648	0.253	0.230	G5EF68.pdb.gz	TAF5_CAEEL Transcription initiation factor TFIID subunit 5 OS=Caenorhabditis elegans OX=6239 GN=taf-5 PE=1 SV=1
13	AFDB:Q9VT91	0.503	0.319	1.325E-40	942	0.244	0.153	Q9VT91.pdb.gz	Q9VT91_DROME Cannonball OS=Drosophila melanogaster OX=7227 GN=can PE=2 SV=1
14	PDB:6mzcG	0.457	0.564	9.765E-33	473	0.301	0.374	6mzcG.pdb.gz
15	PDB:5mzhB	0.423	0.584	1.029E-25	415	0.136	0.193	5mzhB.pdb.gz
16	PDB:5nnzA	0.400	0.673	1.971E-22	335	0.127	0.224	5nnzA.pdb.gz
17	PDB:7pzyh	0.412	0.748	2.084E-22	311	0.117	0.222	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:3dm0A	0.421	0.369	2.203E-22	675	0.154	0.135	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
19	PDB:3jcmB	0.422	0.572	3.250E-22	429	0.143	0.196	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
20	PDB:2h9lA	0.432	0.770	3.354E-21	321	0.132	0.243	2h9lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75529	0.0	1228	589	1.000	1.000	TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens OX=9606 GN=TAF5L PE=1 SV=1
2	Q91WQ5	0.0	1143	589	0.934	0.934	TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus OX=10090 GN=Taf5l PE=2 SV=1
3	Q15542	6.79e-131	404	800	0.387	0.285	TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3
4	Q8C092	2.12e-130	402	801	0.387	0.285	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
5	P49846	3.62e-93	303	704	0.328	0.274	TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1
6	O13282	7.66e-91	295	643	0.323	0.295	TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf5 PE=1 SV=1
7	Q6S7B0	1.84e-86	284	669	0.258	0.227	TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana OX=3702 GN=TAF5 PE=1 SV=1
8	P38129	5.81e-79	267	798	0.238	0.175	TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF5 PE=1 SV=1
9	O74319	1.48e-57	206	642	0.192	0.176	TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1
10	Q9VCN9	2.28e-54	199	743	0.211	0.167	Q9VCN9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=wda PE=2 SV=1
11	G5EF68	6.39e-48	179	648	0.251	0.228	TAF5_CAEEL Transcription initiation factor TFIID subunit 5 OS=Caenorhabditis elegans OX=6239 GN=taf-5 PE=1 SV=1
12	Q9VT91	3.17e-47	180	942	0.238	0.149	Q9VT91_DROME Cannonball OS=Drosophila melanogaster OX=7227 GN=can PE=2 SV=1
13	Q1LV15	4.72e-38	147	415	0.139	0.198	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
14	Q8N136	8.65e-35	138	415	0.124	0.176	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
15	Q57X86	2.87e-34	140	698	0.129	0.109	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
16	D3Z7A5	1.02e-32	132	415	0.124	0.176	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
17	Q4VFZ4	2.14e-31	131	655	0.122	0.110	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
18	B1WBN6	2.20e-31	131	640	0.122	0.113	B1WBN6_RAT Katnb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
19	A0A0G2JX20	2.51e-31	131	659	0.122	0.109	A0A0G2JX20_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=3 SV=2
20	Q8BG40	2.61e-31	131	658	0.122	0.109	KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	5.2e-10	50.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	3.1	18.3	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF15492 Nbas_N	91	13.8	Neuroblastoma-amplified sequence, N terminal
4	PF20426 NBCH_WD40	1.6e-05	35.5	Neurobeachin beta propeller domain
5	PF11715 Nup160	0.9	19.9	Nucleoporin Nup120/160
6	PF04494 TFIID_NTD2	1.6e-26	104.6	WD40 associated region in TFIID subunit, NTD2 domain
7	PF00400 WD40	4.3e-50	177.8	WD domain, G-beta repeat
8	PF17005 WD40_like	4.2	18.2	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258281

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339917	0.998	Transcription initiation factor TFIID subunit 9B
2	9606.ENSP00000360515	0.998	Transcription initiation protein SPT3 homolog
3	9606.ENSP00000307684	0.997	Transcriptional adapter 3
4	9606.ENSP00000294168	0.996	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
5	9606.ENSP00000225916	0.995	Histone acetyltransferase KAT2A
6	9606.ENSP00000263754	0.995	Histone acetyltransferase KAT2B
7	9606.ENSP00000299424	0.995	Transcription initiation factor TFIID subunit 10
8	9606.ENSP00000397259	0.995	Ataxin-7-like protein 3
9	9606.ENSP00000399982	0.995	Transcription initiation factor TFIID subunit 6
10	9606.ENSP00000263974	0.994	Transcription initiation factor TFIID subunit 12
11	9606.ENSP00000316114	0.993	SAGA-associated factor 29
12	9606.ENSP00000312709	0.992	Transcription initiation factor TFIID subunit 7
13	9606.ENSP00000352925	0.992	Transformation/transcription domain-associated protein
14	9606.ENSP00000367406	0.992	Transcription initiation factor TFIID subunit 2
15	9606.ENSP00000308022	0.990	Transcriptional adapter 2-beta
16	9606.ENSP00000356848	0.989	Transcriptional adapter 1
17	9606.ENSP00000370193	0.986	Transcription initiation factor TFIID subunit 9
18	9606.ENSP00000439585	0.985	Ataxin-7
19	9606.ENSP00000261497	0.983	Ubiquitin carboxyl-terminal hydrolase 22
20	9606.ENSP00000417510	0.978	SPT20 homolog, SAGA complex component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	0.999	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.984	cellular process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0044237	0.965	cellular metabolic process
GO:0043170	0.958	macromolecule metabolic process
GO:0036211	0.938	protein modification process
GO:0097659	0.895	nucleic acid-templated transcription
GO:0070646	0.881	protein modification by small protein removal
GO:0006366	0.877	transcription by RNA polymerase II
GO:0043543	0.827	protein acylation
GO:0018205	0.816	peptidyl-lysine modification
GO:0006357	0.792	regulation of transcription by RNA polymerase II
GO:0016570	0.778	histone modification
GO:0006473	0.756	protein acetylation
GO:0006475	0.751	internal protein amino acid acetylation
GO:0016579	0.751	protein deubiquitination
GO:0018393	0.680	internal peptidyl-lysine acetylation
GO:0016573	0.647	histone acetylation
GO:0016578	0.594	histone deubiquitination
GO:0043966	0.594	histone H3 acetylation
GO:0048518	0.411	positive regulation of biological process
GO:0048522	0.334	positive regulation of cellular process
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.993	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0000785	0.923	chromatin
GO:0090575	0.917	RNA polymerase II transcription regulator complex
GO:0055029	0.915	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.914	RNA polymerase II, holoenzyme
GO:0005737	0.897	cytoplasm
GO:0070461	0.896	SAGA-type complex
GO:1905368	0.373	peptidase complex
GO:0000124	0.351	SAGA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]