StarFunc result for job id O75530

User Input

>input (441 residues)
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR
VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM
QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL
SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS
TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ
CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR
DSSILIAVCDDASIWRWDRLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F9ZI63	0.848	0.747	4.482E-84	501	1.000	0.880	A0A5F9ZI63.pdb.gz	A0A5F9ZI63_HUMAN Embryonic ectoderm development OS=Homo sapiens OX=9606 GN=EED PE=1 SV=2
2	PDB:7kxtA	0.824	0.995	1.006E-70	365	0.828	1.000	7kxtA.pdb.gz	Structure-Guided Development of Small-Molecule PRC2 Inhibitors Targeting EZH2-EED Interaction.
3	AFDB:E9PJK2	0.643	0.781	1.570E-60	361	0.816	0.997	E9PJK2.pdb.gz	E9PJK2_HUMAN Embryonic ectoderm development OS=Homo sapiens OX=9606 GN=EED PE=1 SV=1
4	AFDB:Q9VKD5	0.819	0.782	2.629E-60	462	0.535	0.511	Q9VKD5.pdb.gz	Q9VKD5_DROME Escl, isoform A OS=Drosophila melanogaster OX=7227 GN=escl PE=2 SV=1
5	AFDB:Q24338	0.811	0.841	4.995E-56	425	0.492	0.511	Q24338.pdb.gz	ESC_DROME Polycomb protein esc OS=Drosophila melanogaster OX=7227 GN=esc PE=1 SV=1
6	AFDB:Q6ZJX0	0.753	0.879	1.580E-43	376	0.354	0.415	Q6ZJX0.pdb.gz	FIE2_ORYSJ Polycomb group protein FIE1 OS=Oryza sativa subsp. japonica OX=39947 GN=FIE2 PE=1 SV=1
7	AFDB:Q9LT47	0.750	0.892	1.244E-42	369	0.336	0.401	Q9LT47.pdb.gz	FIE_ARATH Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM OS=Arabidopsis thaliana OX=3702 GN=FIE PE=1 SV=2
8	AFDB:Q6ZJW8	0.748	0.709	2.839E-42	466	0.329	0.311	Q6ZJW8.pdb.gz	FIE1_ORYSJ Polycomb group protein FIE1 OS=Oryza sativa subsp. japonica OX=39947 GN=FIE1 PE=1 SV=1
9	PDB:5wg6D	0.589	0.945	2.656E-40	274	0.594	0.956	5wg6D.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
10	AFDB:Q9GYS1	0.749	0.720	4.265E-34	459	0.231	0.222	Q9GYS1.pdb.gz	MES6_CAEEL Polycomb protein mes-6 OS=Caenorhabditis elegans OX=6239 GN=mes-6 PE=1 SV=2
11	AFDB:Q23256	0.609	0.540	6.900E-22	501	0.179	0.158	Q23256.pdb.gz	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
12	AFDB:P90648	0.576	0.357	4.419E-21	732	0.163	0.098	P90648.pdb.gz	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
13	PDB:2h9lA	0.619	0.836	1.262E-19	321	0.150	0.206	2h9lA.pdb.gz
14	PDB:6bk8D	0.597	0.723	1.102E-18	359	0.120	0.148	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
15	PDB:7bt6x	0.528	0.483	8.671E-18	488	0.154	0.139	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:5jcsq	0.547	0.499	1.066E-17	488	0.154	0.139	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	PDB:6zrdA	0.569	0.606	1.182E-17	411	0.150	0.161	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
18	PDB:6tblF	0.610	0.785	2.433E-17	336	0.113	0.149	6tblF.pdb.gz
19	PDB:7jvrB	0.589	0.745	3.491E-17	342	0.120	0.155	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:6ttuT	0.550	0.611	4.757E-17	394	0.138	0.155	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZI63	0.0	924	501	1.000	0.880	A0A5F9ZI63_HUMAN Embryonic ectoderm development OS=Homo sapiens OX=9606 GN=EED PE=1 SV=2
2	A0A8I6A2I3	0.0	896	427	0.968	1.000	A0A8I6A2I3_RAT Embryonic ectoderm development OS=Rattus norvegicus OX=10116 GN=Eed PE=4 SV=1
3	A0A8I6AJ96	0.0	838	404	0.907	0.990	A0A8I6AJ96_RAT Embryonic ectoderm development OS=Rattus norvegicus OX=10116 GN=Eed PE=4 SV=1
4	A0A8I6AQZ9	0.0	788	386	0.850	0.972	A0A8I6AQZ9_RAT Embryonic ectoderm development OS=Rattus norvegicus OX=10116 GN=Eed PE=1 SV=1
5	A0A8J8YPE2	0.0	924	500	1.000	0.882	A0A8J8YPE2_RAT Embryonic ectoderm development OS=Rattus norvegicus OX=10116 GN=Eed PE=1 SV=1
6	B5DF02	0.0	925	441	1.000	1.000	B5DF02_RAT Embryonic ectoderm development OS=Rattus norvegicus OX=10116 GN=Eed PE=2 SV=1
7	E9PJK2	0.0	676	361	0.780	0.953	E9PJK2_HUMAN Embryonic ectoderm development OS=Homo sapiens OX=9606 GN=EED PE=1 SV=1
8	O75530	0.0	925	441	1.000	1.000	EED_HUMAN Polycomb protein EED OS=Homo sapiens OX=9606 GN=EED PE=1 SV=2
9	Q921E6	0.0	925	441	1.000	1.000	EED_MOUSE Polycomb protein EED OS=Mus musculus OX=10090 GN=Eed PE=1 SV=1
10	Q9VKD5	2.00e-169	485	462	0.503	0.481	Q9VKD5_DROME Escl, isoform A OS=Drosophila melanogaster OX=7227 GN=escl PE=2 SV=1
11	Q26458	1.29e-157	454	425	0.483	0.501	ESC_DROVI Polycomb protein esc OS=Drosophila virilis OX=7244 GN=esc PE=3 SV=1
12	Q24338	1.53e-154	446	425	0.463	0.480	ESC_DROME Polycomb protein esc OS=Drosophila melanogaster OX=7227 GN=esc PE=1 SV=1
13	Q6ZJX0	6.15e-95	292	376	0.356	0.418	FIE2_ORYSJ Polycomb group protein FIE1 OS=Oryza sativa subsp. japonica OX=39947 GN=FIE2 PE=1 SV=1
14	Q9LT47	7.06e-90	279	369	0.338	0.404	FIE_ARATH Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM OS=Arabidopsis thaliana OX=3702 GN=FIE PE=1 SV=2
15	Q6ZJW8	1.93e-86	273	466	0.320	0.303	FIE1_ORYSJ Polycomb group protein FIE1 OS=Oryza sativa subsp. japonica OX=39947 GN=FIE1 PE=1 SV=1
16	Q95SW6	1.06e-82	254	190	0.252	0.584	Q95SW6_DROME SD02661p OS=Drosophila melanogaster OX=7227 GN=escl PE=1 SV=1
17	Q9GYS1	2.53e-30	124	459	0.238	0.229	MES6_CAEEL Polycomb protein mes-6 OS=Caenorhabditis elegans OX=6239 GN=mes-6 PE=1 SV=2
18	Q9D4T2	2.96e-12	69.3	304	0.075	0.109	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
19	A6H6T7	1.09e-11	67.8	310	0.075	0.106	A6H6T7_MOUSE Dynein assembly factor with WDR repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=1 SV=1
20	Q9D3X2	1.14e-11	67.8	310	0.075	0.106	Q9D3X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	9.5	17.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	1.7e+02	12.5	Neurobeachin beta propeller domain
3	PF11715 Nup160	7.1	16.9	Nucleoporin Nup120/160
4	PF00400 WD40	2.7e-07	42.3	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010632034.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010614128.1	0.999	Zinc finger protein AEBP2
2	885580.XP_010640667.1	0.999	Polycomb protein SUZ12
3	885580.XP_010621197.1	0.998	Protein Jumonji
4	885580.XP_010619839.1	0.996	Histone-binding protein RBBP4
5	885580.XP_010633819.1	0.996	Histone-lysine N-methyltransferase EZH1
6	885580.XP_010636886.1	0.996	Histone-lysine N-methyltransferase EZH2 isoform X1
7	885580.XP_010636914.1	0.996	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
8	885580.XP_010641939.1	0.995	Histone-binding protein RBBP7
9	885580.XP_010618133.1	0.994	Polycomb complex protein BMI-1
10	885580.XP_010641411.1	0.987	Ubiquitin carboxyl-terminal hydrolase
11	885580.XP_010639944.1	0.986	Polycomb group RING finger protein 3
12	885580.XP_010629888.1	0.982	Polycomb group RING finger protein 1
13	885580.XP_010630037.1	0.981	E3 ubiquitin-protein ligase RING2
14	885580.XP_010630405.1	0.978	Polycomb group RING finger protein 5 isoform X1
15	885580.XP_010612269.1	0.974	Chromobox protein homolog 7
16	885580.XP_010603585.1	0.973	PHD finger protein 1
17	885580.XP_010612361.1	0.972	Histone deacetylase 2
18	885580.XP_010643511.1	0.971	Polyhomeotic-like protein 2
19	885580.XP_010619862.1	0.963	Histone deacetylase 1
20	885580.XP_010603569.1	0.961	E3 ubiquitin-protein ligase RING1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003824	0.654	catalytic activity
GO:1901363	0.388	heterocyclic compound binding
GO:0097159	0.388	organic cyclic compound binding
GO:0003676	0.383	nucleic acid binding
GO:0016740	0.374	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000122	0.998	negative regulation of transcription by RNA polymerase II
GO:0007417	0.997	central nervous system development
GO:0048513	0.859	animal organ development
GO:0021510	0.701	spinal cord development
GO:0009987	0.639	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.955	nucleoplasm
GO:0032991	0.865	protein-containing complex
GO:0005737	0.666	cytoplasm
GO:0140513	0.300	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.374	Transferases.

[back to server]