StarFunc result for job id O75533

User Input

>input (1304 residues)
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTE
RDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI
GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG
YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM
SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNL
AKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQA
RHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSP
DEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL
ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF
QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRL
TPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT
FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPE
LNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK
VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QQZ1	0.715	0.709	0.000	1315	0.942	0.935	F1QQZ1.pdb.gz	F1QQZ1_DANRE Splicing factor 3B subunit 1 isoform X1 OS=Danio rerio OX=7955 GN=sf3b1 PE=1 SV=2
2	PDB:6ahd1	0.628	0.777	1.742E-77	1048	0.687	0.855	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
3	AFDB:P49955	0.520	0.672	1.860E-63	971	0.356	0.478	P49955.pdb.gz	SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSH155 PE=1 SV=1
4	PDB:5gm6G	0.608	0.898	8.538E-54	875	0.342	0.510	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
5	AFDB:Q382Z6	0.632	0.748	2.863E-50	1099	0.278	0.329	Q382Z6.pdb.gz	Q382Z6_TRYB2 Splicing factor 3B subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3690 PE=3 SV=1
6	PDB:5lqwQ	0.583	0.947	5.008E-41	791	0.321	0.528	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
7	PDB:4a0cA	0.317	0.353	1.446E-13	1155	0.085	0.096	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
8	PDB:7unkA	0.222	0.265	3.352E-12	1047	0.097	0.120	7unkA.pdb.gz
9	PDB:1b3uA	0.225	0.402	6.849E-12	588	0.077	0.172	1b3uA.pdb.gz
10	PDB:6xu2A	0.298	0.343	7.623E-12	1091	0.087	0.104	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
11	PDB:4jlqA	0.283	0.399	2.662E-11	840	0.085	0.132	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	PDB:3w3uA	0.255	0.298	4.389E-11	1030	0.082	0.104	3w3uA.pdb.gz
13	PDB:3nd2A	0.321	0.440	8.349E-11	861	0.079	0.120	3nd2A.pdb.gz
14	AFDB:G5E870	0.157	0.107	9.903E-10	2025	0.099	0.064	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
15	AFDB:Q99569	0.112	0.119	3.056E-8	1192	0.117	0.128	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
16	AFDB:F4K0Y5	0.094	0.100	1.370E-7	1165	0.113	0.126	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
17	AFDB:Q9W517	0.072	0.061	1.472E-7	1741	0.135	0.101	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
18	AFDB:E9PR38	0.156	0.201	4.382E-6	944	0.093	0.128	E9PR38.pdb.gz	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
19	AFDB:Q54WA7	0.109	0.152	5.429E-6	785	0.084	0.139	Q54WA7.pdb.gz	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
20	AFDB:A0A0R4IWL6	0.146	0.158	9.615E-6	1152	0.108	0.122	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AP19	0.0	2679	1297	0.992	0.998	A0A8I6AP19_RAT Splicing factor 3b, subunit 1 OS=Rattus norvegicus OX=10116 GN=Sf3b1 PE=1 SV=1
2	F1QQZ1	0.0	2502	1315	0.944	0.936	F1QQZ1_DANRE Splicing factor 3B subunit 1 isoform X1 OS=Danio rerio OX=7955 GN=sf3b1 PE=1 SV=2
3	G3V7T6	0.0	2700	1304	1.000	1.000	G3V7T6_RAT Splicing factor 3b, subunit 1 OS=Rattus norvegicus OX=10116 GN=Sf3b1 PE=1 SV=1
4	G5EEQ8	0.0	1694	1322	0.676	0.666	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
5	O75533	0.0	2700	1304	1.000	1.000	SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3
6	P49955	0.0	940	971	0.348	0.468	SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSH155 PE=1 SV=1
7	Q10178	0.0	1288	1205	0.465	0.503	SF3B1_SCHPO U2 snRNP component prp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp10 PE=1 SV=3
8	Q382Z6	0.0	572	1099	0.285	0.338	Q382Z6_TRYB2 Splicing factor 3B subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3690 PE=3 SV=1
9	Q99NB9	0.0	2699	1304	0.999	0.999	SF3B1_MOUSE Splicing factor 3B subunit 1 OS=Mus musculus OX=10090 GN=Sf3b1 PE=1 SV=1
10	Q9FMF9	0.0	1677	1269	0.686	0.705	Q9FMF9_ARATH Nuclear protein-like OS=Arabidopsis thaliana OX=3702 GN=MSJ1.11 PE=1 SV=1
11	Q9VPR5	0.0	2016	1340	0.799	0.778	Q9VPR5_DROME Splicing factor 3b subunit 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sf3b1 PE=1 SV=2
12	B4DGZ4	7.25e-90	289	154	0.107	0.909	B4DGZ4_HUMAN Splicing factor 3b subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=1
13	Q5FVK4	1.20e-48	169	74	0.057	1.000	Q5FVK4_RAT Sf3b1 protein OS=Rattus norvegicus OX=10116 GN=Sf3b1 PE=2 SV=1
14	Q9UT08	3.97e-04	47.0	590	0.058	0.129	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
15	P31383	7.06e-04	46.2	635	0.040	0.082	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
16	Q38845	0.002	45.1	588	0.040	0.088	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
17	Q38951	0.002	44.7	587	0.047	0.104	2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
18	Q54VJ6	0.002	44.7	462	0.025	0.069	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
19	A8K7B7	0.004	43.9	589	0.103	0.228	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
20	P30153	0.004	43.9	589	0.103	0.228	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	34	14.5	Adaptin N terminal region
2	PF12348 CLASP_N	2.7e+02	12.5	CLASP N terminal
3	PF12717 Cnd1	8.4	17.9	non-SMC mitotic condensation complex subunit 1
4	PF04931 DNA_pol_phi	1.3e+02	12.1	DNA polymerase phi
5	PF07539 DRIM	26	14.6	Down-regulated in metastasis
6	PF11865 DUF3385	17	16.8	Domain of unknown function (DUF3385)
7	PF20416 DUF6700	6.8	17.6	Domain of unknown function (DUF6700)
8	PF02985 HEAT	0.00021	32.3	HEAT repeat
9	PF13646 HEAT_2	0.00014	33.5	HEAT repeats
10	PF13513 HEAT_EZ	0.0022	29.8	HEAT-like repeat
11	PF05004 IFRD	1e+02	13.4	Interferon-related developmental regulator (IFRD)
12	PF08161 NUC173	20	16.3	NUC173 domain
13	PF08920 SF3b1	4.7e-46	167.9	Splicing factor 3B subunit 1
14	PF08064 UME	93	14.4	UME (NUC010) domain
15	PF11701 UNC45-central	97	14.3	Myosin-binding striated muscle assembly central
16	PF12755 Vac14_Fab1_bd	0.21	23.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9402.XP_006921372.1

Rank	PPI partner	STRING score	Description
1	9402.XP_006909900.1	0.999	Splicing factor 3B subunit 3 isoform X1
2	9402.XP_006910334.1	0.999	pre-mRNA branch site protein p14-like
3	9402.XP_006911137.1	0.998	Splicing factor 3B subunit 2 isoform X1
4	9402.XP_006917441.1	0.998	PHD finger-like domain-containing protein 5A
5	9402.XP_006919788.1	0.998	Splicing factor 3B subunit 4
6	9402.XP_006915410.1	0.997	Splicing factor 3B subunit 5
7	9402.XP_006909496.1	0.996	U5 small nuclear ribonucleoprotein 200 kDa helicase
8	9402.XP_006925127.1	0.996	pre-mRNA-processing-splicing factor 8 isoform X1
9	9402.XP_006922054.1	0.995	pre-mRNA-processing factor 6
10	9402.XP_006904969.1	0.994	Splicing factor 3A subunit 1
11	9402.XP_006910200.1	0.993	116 kDa U5 small nuclear ribonucleoprotein component isoform X1
12	9402.XP_006924279.1	0.993	Splicing factor 3A subunit 3
13	9402.XP_006925484.1	0.991	RNA-binding protein 25
14	9402.XP_006919018.1	0.990	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
15	9402.XP_006904131.1	0.989	Splicing factor 3A subunit 2
16	9402.XP_006907166.1	0.988	U2 small nuclear ribonucleoprotein A'
17	9402.XP_006913023.1	0.987	poly(U)-binding-splicing factor PUF60 isoform X1
18	9402.XP_006923177.1	0.986	Putative ATP-dependent RNA helicase DDX46
19	9402.XP_006921310.1	0.983	Pre-mRNA-splicing factor CWC22 like protein
20	9402.XP_006922936.1	0.981	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:1990935	0.414	splicing factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0016071	0.916	mRNA metabolic process
GO:0000398	0.867	mRNA splicing, via spliceosome
GO:0050789	0.856	regulation of biological process
GO:0050794	0.809	regulation of cellular process
GO:0048518	0.440	positive regulation of biological process
GO:0032502	0.427	developmental process
GO:0048522	0.422	positive regulation of cellular process
GO:0048856	0.338	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0031981	0.986	nuclear lumen
GO:0032991	0.979	protein-containing complex
GO:1990904	0.879	ribonucleoprotein complex
GO:0120114	0.762	Sm-like protein family complex
GO:0030532	0.754	small nuclear ribonucleoprotein complex
GO:0043232	0.688	intracellular non-membrane-bounded organelle
GO:0005681	0.645	spliceosomal complex
GO:0005654	0.465	nucleoplasm
GO:0005684	0.407	U2-type spliceosomal complex
GO:0097525	0.343	spliceosomal snRNP complex
GO:0005686	0.314	U2 snRNP

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]