StarFunc result for job id O75541

User Input

>input (412 residues)
MSRRKQTNPNKVHWDQVFAGLEEQARQAMMKTDFPGDLGSQRQAIQQLRDQDSSSSDSEG
DEEETTQDEVSSHTSEEDGGVVKVEKELENTEQPVGGNEVVEHEVTGNLNSDPLLELCQC
PLCQLDCGSREQLIAHVYQHTAAVVSAKSYMCPVCGRALSSPGSLGRHLLIHSEDQRSNC
AVCGARFTSHATFNSEKLPEVLNMESLPTVHNEGPSSAEGKDIAFSPPVYPAGILLVCNN
CAAYRKLLEAQTPSVRKWALRRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRD
REAKRLQRMQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRLKRRLEKMD
MMLRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75541	1.000	1.000	2.369E-68	412	1.000	1.000	O75541.pdb.gz	ZN821_HUMAN Zinc finger protein 821 OS=Homo sapiens OX=9606 GN=ZNF821 PE=1 SV=3
2	AFDB:M9PG92	0.099	0.059	4.661E-5	794	0.163	0.084	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
3	AFDB:Q811H0	0.088	0.086	6.934E-5	420	0.102	0.100	Q811H0.pdb.gz	ZBT42_MOUSE Zinc finger and BTB domain-containing protein 42 OS=Mus musculus OX=10090 GN=Zbtb42 PE=1 SV=2
4	AFDB:O60765	0.106	0.083	9.037E-5	605	0.131	0.089	O60765.pdb.gz	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
5	AFDB:Q95RA7	0.089	0.083	1.032E-4	447	0.085	0.078	Q95RA7.pdb.gz	Q95RA7_DROME LD47721p OS=Drosophila melanogaster OX=7227 GN=CG14710 PE=2 SV=1
6	AFDB:Q02085	0.095	0.143	1.258E-4	264	0.095	0.148	Q02085.pdb.gz	SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus OX=10090 GN=Snai1 PE=1 SV=1
7	AFDB:A7E2L3	0.095	0.146	1.640E-4	253	0.068	0.111	A7E2L3.pdb.gz	A7E2L3_DANRE Uncharacterized protein LOC100124596 OS=Danio rerio OX=7955 GN=zgc:171929 PE=2 SV=1
8	AFDB:Q9Y3M9	0.087	0.050	1.872E-4	751	0.124	0.068	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
9	AFDB:A0A1D5P5P2	0.086	0.086	2.440E-4	412	0.107	0.107	A0A1D5P5P2.pdb.gz
10	AFDB:Q96SZ4	0.091	0.059	2.976E-4	725	0.119	0.068	Q96SZ4.pdb.gz	ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZSCAN10 PE=1 SV=1
11	PDB:3w5kB	0.071	0.223	3.294E-2	110	0.053	0.200	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7o4iW	0.050	0.064	1.343	312	0.078	0.103	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:4kfzB	0.091	0.203	2.135	148	0.066	0.182	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:7pfoB	0.048	0.030	4.140	759	0.022	0.012	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
15	PDB:7qhsG	0.046	0.030	5.050	756	0.039	0.021	7qhsG.pdb.gz	Mechanism of replication origin melting nucleated by CMG helicase assembly.
16	PDB:5a4pA	0.063	0.099	5.396	227	0.012	0.022	5a4pA.pdb.gz
17	PDB:7vhpG	0.082	0.103	6.159	299	0.068	0.094	7vhpG.pdb.gz
18	PDB:6hivBe	0.034	0.111	6.581	101	0.024	0.099	6hivBe.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6fyxm	0.060	0.112	8.027	147	0.015	0.041	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:1b8tA	0.054	0.084	8.577	192	0.056	0.120	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75541	0.0	850	412	1.000	1.000	ZN821_HUMAN Zinc finger protein 821 OS=Homo sapiens OX=9606 GN=ZNF821 PE=1 SV=3
2	Q92766	2.44e-12	71.2	1687	0.095	0.023	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
3	Q3UH06	5.21e-12	70.5	1700	0.073	0.018	RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus OX=10090 GN=Rreb1 PE=1 SV=2
4	O46205	1.35e-07	56.2	1920	0.053	0.011	O46205_DROME Zinc-finger nuclear protein hindsight OS=Drosophila melanogaster OX=7227 GN=peb PE=2 SV=1
5	Q7K3V3	1.42e-07	56.2	1893	0.053	0.012	Q7K3V3_DROME GH10905p OS=Drosophila melanogaster OX=7227 GN=peb PE=2 SV=1
6	Q9W4J1	1.42e-07	56.2	1894	0.053	0.012	Q9W4J1_DROME Pebbled, isoform A OS=Drosophila melanogaster OX=7227 GN=peb PE=4 SV=2
7	Q5J2I5	9.34e-07	53.1	478	0.075	0.065	Q5J2I5_DANRE Bloody fingers OS=Danio rerio OX=7955 GN=zgc:123026 PE=2 SV=1
8	F1QUN0	4.59e-06	51.2	1008	0.097	0.040	F1QUN0_DANRE Zinc finger protein 574 OS=Danio rerio OX=7955 GN=si:ch211-87d12.1 PE=1 SV=1
9	D2KMS9	4.80e-06	51.2	1009	0.097	0.040	D2KMS9_DANRE Rumba zinc finger protein OS=Danio rerio OX=7955 GN=si:ch211-87d12.1 PE=1 SV=1
10	Q9V3X8	5.19e-06	50.4	329	0.056	0.070	Q9V3X8_DROME EG:BACR42I17.11 protein OS=Drosophila melanogaster OX=7227 GN=EG:BACR42I17.11 PE=2 SV=1
11	Q60821	5.56e-06	51.2	794	0.061	0.031	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
12	Q9VY72	7.12e-06	50.8	1553	0.061	0.016	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4
13	Q804Q5	1.84e-05	48.9	430	0.070	0.067	FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio OX=7955 GN=fezf2 PE=1 SV=2
14	Q13105	1.97e-05	49.3	803	0.061	0.031	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
15	Q07231	2.04e-05	48.9	555	0.063	0.047	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
16	Q5FWF6	2.05e-05	48.9	425	0.056	0.054	ZN789_HUMAN Zinc finger protein 789 OS=Homo sapiens OX=9606 GN=ZNF789 PE=1 SV=3
17	P17098	2.28e-05	48.9	575	0.063	0.045	ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens OX=9606 GN=ZNF8 PE=1 SV=2
18	Q3ZBY5	2.46e-05	48.5	466	0.063	0.056	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
19	Q05516	2.64e-05	48.9	673	0.063	0.039	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
20	A3KMN0	2.65e-05	48.9	651	0.063	0.040	A3KMN0_MOUSE Zbtb16 protein (Fragment) OS=Mus musculus OX=10090 GN=Zbtb16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19474 DUF6011	6.8e+02	11.2	Family of unknown function (DUF6011)
2	PF00096 zf-C2H2	18	17.2	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	27	16.0	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	0.0023	29.6	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	20	16.6	C2H2-type zinc finger
6	PF16293 zf-C2H2_9	22	16.3	C2H2 type zinc-finger (1 copy)
7	PF12171 zf-C2H2_jaz	1.9e+02	13.7	Zinc-finger double-stranded RNA-binding
8	PF05605 zf-Di19	0.22	23.1	Drought induced 19 protein (Di19), zinc-binding
9	PF13465 zf-H2C2_2	5.7	18.7	Zinc-finger double domain
10	PF12874 zf-met	0.0017	29.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228741	0.641	ETS domain-containing protein Elk-3
2	9606.ENSP00000354152	0.637	Methenyltetrahydrofolate synthase domain-containing protein
3	9606.ENSP00000420270	0.580	Serine/threonine-protein kinase Kist
4	9606.ENSP00000481721	0.570	TBC1 domain family member 2A
5	9606.ENSP00000304553	0.560	M-phase-specific PLK1-interacting protein
6	9606.ENSP00000377504	0.541	Zinc finger protein 414
7	9606.ENSP00000342974	0.535	Zinc finger protein 791

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.811	transcription regulator activity
GO:0003700	0.756	DNA-binding transcription factor activity
GO:0000981	0.426	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0019222	0.827	regulation of metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0060255	0.812	regulation of macromolecule metabolic process
GO:0009987	0.766	cellular process
GO:0031323	0.714	regulation of cellular metabolic process
GO:0010468	0.702	regulation of gene expression
GO:0019219	0.701	regulation of nucleobase-containing compound metabolic process
GO:1903506	0.685	regulation of nucleic acid-templated transcription
GO:0006355	0.677	regulation of DNA-templated transcription
GO:0048519	0.669	negative regulation of biological process
GO:0048523	0.426	negative regulation of cellular process
GO:0071704	0.342	organic substance metabolic process
GO:0048518	0.324	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.993	nuclear lumen
GO:0005654	0.935	nucleoplasm
GO:0005737	0.702	cytoplasm
GO:0043232	0.310	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]