StarFunc result for job id O75556

User Input

>input (95 residues)
MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMG
KFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75556	1.000	1.000	7.693E-14	95	1.000	1.000	O75556.pdb.gz	SG2A1_HUMAN Mammaglobin-B OS=Homo sapiens OX=9606 GN=SCGB2A1 PE=1 SV=1
2	AFDB:Q13296	0.724	0.739	9.598E-7	93	0.568	0.581	Q13296.pdb.gz	SG2A2_HUMAN Mammaglobin-A OS=Homo sapiens OX=9606 GN=SCGB2A2 PE=1 SV=1
3	AFDB:P02780	0.715	0.715	1.191E-5	95	0.347	0.347	P02780.pdb.gz	SG2A2_RAT Secretoglobin family 2A member 2 OS=Rattus norvegicus OX=10116 GN=Scgb2a2 PE=1 SV=1
4	AFDB:Q863D2	0.717	0.731	4.319E-5	93	0.421	0.430	Q863D2.pdb.gz
5	AFDB:P11684	0.642	0.667	1.243E-1	91	0.200	0.209	P11684.pdb.gz	UTER_HUMAN Uteroglobin OS=Homo sapiens OX=9606 GN=SCGB1A1 PE=1 SV=1
6	AFDB:Q7M745	0.598	0.520	1.873E-1	112	0.200	0.170	Q7M745.pdb.gz	Q7M745_MOUSE Allergen dI chain C2D OS=Mus musculus OX=10090 GN=Scgb2b26 PE=2 SV=1
7	AFDB:Q4G0G5	0.553	0.548	2.510E-1	96	0.200	0.198	Q4G0G5.pdb.gz	SC2B2_HUMAN Secretoglobin family 2B member 2 OS=Homo sapiens OX=9606 GN=SCGB2B2 PE=1 SV=1
8	AFDB:P17559	0.647	0.641	2.992E-1	96	0.168	0.167	P17559.pdb.gz	UTER_RAT Uteroglobin OS=Rattus norvegicus OX=10116 GN=Scgb1a1 PE=1 SV=2
9	AFDB:Q91WB5	0.643	0.661	2.992E-1	92	0.221	0.228	Q91WB5.pdb.gz	Q91WB5_MOUSE ABPA27 OS=Mus musculus OX=10090 GN=Scgb1b27 PE=1 SV=1
10	AFDB:P0DMR2	0.519	0.519	3.172E-1	95	0.147	0.147	P0DMR2.pdb.gz	SG1C2_HUMAN Secretoglobin family 1C member 2 OS=Homo sapiens OX=9606 GN=SCGB1C2 PE=1 SV=1
11	PDB:1ccdA	0.488	0.592	1.511	77	0.095	0.117	1ccdA.pdb.gz
12	PDB:6tz402	0.213	0.141	4.876	176	0.116	0.062	6tz402.pdb.gz
13	PDB:4hg6A	0.199	0.034	6.163	747	0.137	0.017	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
14	PDB:7dvqK	0.244	0.146	6.163	188	0.137	0.069	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3uo2B	0.261	0.187	8.259	150	0.232	0.147	3uo2B.pdb.gz
16	PDB:1bp3A	0.171	0.113	9.286	186	0.168	0.086	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
17	PDB:6s7oC	0.224	0.265	9.845	78	0.074	0.090	6s7oC.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75556	6.74e-67	197	95	1.000	1.000	SG2A1_HUMAN Mammaglobin-B OS=Homo sapiens OX=9606 GN=SCGB2A1 PE=1 SV=1
2	Q13296	1.59e-26	95.5	93	0.442	0.452	SG2A2_HUMAN Mammaglobin-A OS=Homo sapiens OX=9606 GN=SCGB2A2 PE=1 SV=1
3	P02780	3.61e-20	79.3	95	0.358	0.358	SG2A2_RAT Secretoglobin family 2A member 2 OS=Rattus norvegicus OX=10116 GN=Scgb2a2 PE=1 SV=1
4	C6KT15	0.91	30.4	2394	0.137	0.005	C6KT15_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0617400 PE=4 SV=1
5	Q5LSI0	4.9	28.1	364	0.211	0.055	Q5LSI0_RUEPO ABC transporter, periplasmic substrate-binding protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO1788 PE=4 SV=1
6	Q4V914	6.7	27.7	367	0.147	0.038	Q4V914_DANRE Core histone macro-H2A OS=Danio rerio OX=7955 GN=zgc:114051 PE=1 SV=1
7	Q9ASZ8	7.0	27.7	621	0.168	0.026	PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1
8	F1MH24	7.2	27.7	957	0.168	0.017	AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus OX=9913 GN=AAK1 PE=1 SV=2
9	F1SPM8	7.2	27.7	968	0.168	0.017	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
10	P0C1X8	7.2	27.7	962	0.168	0.017	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
11	Q2M2I8	7.2	27.7	961	0.168	0.017	AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3
12	Q3UHJ0	7.2	27.7	959	0.168	0.017	AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Aak1 PE=1 SV=2
13	Q4Q396	8.0	27.7	1436	0.200	0.013	Q4Q396_LEIMA Dihydroxyacetonephosphate acyltransferase OS=Leishmania major OX=5664 GN=DAT PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01099 Uteroglobin	1.8e-24	97.3	Uteroglobin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244926	0.904	Secretoglobin family 1D member 2
2	9606.ENSP00000303070	0.837	Secretoglobin family 1D member 1
3	9606.ENSP00000278282	0.706	Uteroglobin
4	9606.ENSP00000351395	0.596	Secretoglobin family 1D member 4
5	9606.ENSP00000227918	0.568	Mammaglobin-A
6	9606.ENSP00000228811	0.565	Proline-rich protein 4
7	9606.ENSP00000385968	0.539	Potassium voltage-gated channel subfamily S member 3
8	9606.ENSP00000274793	0.538	Platelet-activating factor acetylhydrolase
9	9606.ENSP00000296694	0.537	Secretoglobin family 3A member 2
10	9606.ENSP00000332812	0.535	Prostaglandin D2 receptor 2
11	9606.ENSP00000407422	0.535	Mucin-7
12	9606.ENSP00000280097	0.508	Histamine N-methyltransferase
13	9606.ENSP00000367570	0.506	PHD finger protein 11
14	9606.ENSP00000231751	0.504	Lactotransferrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009755	0.991	hormone-mediated signaling pathway
GO:0030522	0.986	intracellular receptor signaling pathway
GO:0071383	0.986	cellular response to steroid hormone stimulus
GO:0043401	0.980	steroid hormone mediated signaling pathway
GO:0030518	0.937	intracellular steroid hormone receptor signaling pathway
GO:0032501	0.325	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043227	0.443	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]