StarFunc result for job id O75570

User Input

>input (445 residues)
MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRR
YCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIY
QEIQETEQAIEELESMCKSLNKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKY
DKNDVILEVTAGRTTGGDICQQFTREIFDMYQNYSCYKHWQFELLNYTPADYGGLHHAAA
RISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDVKLDPKDL
RIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFRVLRARLYQQI
IEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQL
IQRLLQSADEEAIAELLDEHLKSAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75570	1.000	1.000	8.081E-77	445	1.000	1.000	O75570.pdb.gz	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
2	AFDB:Q8K126	0.914	0.912	5.681E-64	446	0.818	0.816	Q8K126.pdb.gz	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
3	AFDB:Q8BJU9	0.745	0.881	5.930E-38	373	0.375	0.448	Q8BJU9.pdb.gz	RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1l PE=2 SV=1
4	AFDB:Q9UGC7	0.702	0.819	7.694E-37	380	0.366	0.429	Q9UGC7.pdb.gz	RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1L PE=1 SV=1
5	AFDB:Q8RX79	0.646	0.679	2.559E-32	422	0.299	0.315	Q8RX79.pdb.gz	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
6	AFDB:O51214	0.574	0.691	3.526E-32	357	0.306	0.381	O51214.pdb.gz	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
7	AFDB:P0A7I0	0.623	0.755	2.053E-31	360	0.310	0.383	P0A7I0.pdb.gz	RF1_ECOLI Peptide chain release factor RF1 OS=Escherichia coli (strain K12) OX=83333 GN=prfA PE=1 SV=1
8	AFDB:Q09691	0.691	0.770	9.660E-31	396	0.281	0.316	Q09691.pdb.gz	RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F7.17 PE=3 SV=1
9	AFDB:P30775	0.606	0.647	2.270E-30	413	0.279	0.300	P30775.pdb.gz	RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRF1 PE=1 SV=1
10	PDB:7nqhBL	0.525	0.910	4.849E-28	250	0.312	0.556	7nqhBL.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
11	AFDB:P07012	0.616	0.731	3.389E-26	365	0.229	0.279	P07012.pdb.gz	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
12	PDB:6gxnv	0.520	0.654	4.537E-26	348	0.303	0.388	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
13	PDB:6c4iv	0.544	0.647	1.383E-24	362	0.227	0.279	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
14	PDB:2b3tB	0.410	0.588	1.509E-21	300	0.276	0.410	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
15	PDB:5u4jv	0.218	0.715	3.771E-6	132	0.061	0.205	5u4jv.pdb.gz	Structural basis of co-translational quality control by ArfA and RF2 bound to ribosome.
16	PDB:7a5hC	0.141	0.527	3.323E-3	114	0.056	0.219	7a5hC.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
17	PDB:7jss8	0.139	0.443	8.632E-2	132	0.056	0.189	7jss8.pdb.gz	ArfB can displace mRNA to rescue stalled ribosomes.
18	PDB:6agbH	0.123	0.309	2.257E-1	131	0.031	0.107	6agbH.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
19	PDB:3kg0B	0.130	0.389	2.794E-1	98	0.025	0.112	3kg0B.pdb.gz
20	PDB:2gqqC	0.094	0.195	4.061E-1	157	0.040	0.115	2gqqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75570	0.0	925	445	1.000	1.000	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
2	Q8K126	0.0	741	446	0.820	0.818	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
3	Q9UGC7	5.36e-108	326	380	0.357	0.418	RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1L PE=1 SV=1
4	Q8BJU9	8.90e-107	322	373	0.355	0.424	RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1l PE=2 SV=1
5	O51214	1.55e-77	247	357	0.288	0.359	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
6	P0A7I0	4.03e-75	241	360	0.317	0.392	RF1_ECOLI Peptide chain release factor RF1 OS=Escherichia coli (strain K12) OX=83333 GN=prfA PE=1 SV=1
7	Q8RX79	5.28e-69	227	422	0.270	0.284	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
8	Q09691	1.96e-60	204	396	0.272	0.306	RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F7.17 PE=3 SV=1
9	P30775	2.17e-58	199	413	0.288	0.310	RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRF1 PE=1 SV=1
10	P07012	2.26e-47	168	365	0.227	0.277	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
11	Q57WY8	1.34e-35	139	459	0.200	0.194	Q57WY8_TRYB2 Peptide chain release factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.190 PE=3 SV=1
12	Q9LVY0	2.36e-28	118	456	0.193	0.189	PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB1 PE=2 SV=1
13	P9WHG1	2.30e-27	114	371	0.175	0.210	RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prfB PE=1 SV=1
14	Q9C875	1.95e-11	66.2	257	0.074	0.128	Q9C875_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=T16O9.18 PE=1 SV=1
15	Q9HTA0	5.51e-10	61.2	204	0.063	0.137	Q9HTA0_PSEAE Probable peptide chain release factor OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5470 PE=3 SV=1
16	Q05863	1.36e-07	53.1	155	0.049	0.142	YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR281C PE=1 SV=1
17	Q9H3J6	1.48e-07	53.1	166	0.056	0.151	MTRFR_HUMAN Mitochondrial translation release factor in rescue OS=Homo sapiens OX=9606 GN=MTRFR PE=1 SV=1
18	Q9Y811	1.16e-05	47.8	162	0.070	0.191	YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.18c PE=3 SV=2
19	P40711	1.00e-04	44.3	140	0.085	0.271	ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB OS=Escherichia coli (strain K12) OX=83333 GN=arfB PE=1 SV=2
20	F4J264	0.034	38.9	406	0.117	0.128	PRFB3_ARATH Peptide chain release factor PrfB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	52	15.6	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF14257 DUF4349	3.2e+02	12.1	Domain of unknown function (DUF4349)
3	PF09058 L27_1	89	14.3	L27_1
4	PF03462 PCRF	5e-46	168.5	PCRF domain
5	PF00472 RF-1	2.7e-36	135.4	RF-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008956949.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008972105.1	0.876	Belongs to the universal ribosomal protein uS11 family.
2	9597.XP_003810511.1	0.787	Ribosome-releasing factor 2, mitochondrial isoform X1
3	9597.XP_003813354.1	0.732	Mitochondrial ribosomal protein S7
4	9597.XP_003819140.1	0.725	Belongs to the bacterial ribosomal protein bL17 family.
5	9597.XP_003811723.1	0.715	Belongs to the universal ribosomal protein uS9 family.
6	9597.XP_003816611.1	0.713	Mitochondrial ribosomal protein L35
7	9597.XP_003816037.2	0.704	28S ribosomal protein S16, mitochondrial
8	9597.XP_003817504.1	0.703	39S ribosomal protein L27, mitochondrial
9	9597.XP_003817285.1	0.688	39S ribosomal protein L9, mitochondrial isoform X1
10	9597.XP_008972192.1	0.686	Belongs to the universal ribosomal protein uL13 family.
11	9597.XP_003832283.1	0.679	GUF1 homolog, GTPase
12	9597.XP_003830681.1	0.678	Elongation factor G, mitochondrial isoform X1
13	9597.XP_003806944.1	0.675	Von Willebrand factor A domain-containing protein 8
14	9597.XP_003812302.1	0.673	Belongs to the universal ribosomal protein uS12 family.
15	9597.XP_003825371.1	0.672	Tudor domain containing 3
16	9597.XP_003806946.1	0.671	N(alpha)-acetyltransferase 16, NatA auxiliary subunit
17	9597.XP_003833325.2	0.671	Mitochondrial ribosomal protein L2
18	9597.XP_008975939.1	0.661	Solute carrier family 5 member 3
19	9597.XP_003828129.1	0.652	Acid sphingomyelinase-like phosphodiesterase 3b isoform X1
20	9597.XP_003829506.1	0.647	Belongs to the universal ribosomal protein uL3 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003747	1.000	translation release factor activity
GO:0005515	0.866	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0010608	0.975	post-transcriptional regulation of gene expression
GO:0034248	0.953	regulation of amide metabolic process
GO:2000112	0.953	regulation of cellular macromolecule biosynthetic process
GO:0051246	0.938	regulation of protein metabolic process
GO:0006417	0.893	regulation of translation
GO:0043244	0.836	regulation of protein-containing complex disassembly
GO:0008152	0.817	metabolic process
GO:0071704	0.814	organic substance metabolic process
GO:0044237	0.808	cellular metabolic process
GO:0044238	0.798	primary metabolic process
GO:0006807	0.791	nitrogen compound metabolic process
GO:0043170	0.773	macromolecule metabolic process
GO:1901564	0.706	organonitrogen compound metabolic process
GO:0034641	0.706	cellular nitrogen compound metabolic process
GO:0010467	0.692	gene expression
GO:0019538	0.692	protein metabolic process
GO:0044249	0.589	cellular biosynthetic process
GO:0044260	0.587	cellular macromolecule metabolic process
GO:1901576	0.586	organic substance biosynthetic process
GO:0044271	0.577	cellular nitrogen compound biosynthetic process
GO:0006412	0.573	translation
GO:0071840	0.396	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.947	intracellular organelle lumen
GO:0043232	0.445	intracellular non-membrane-bounded organelle
GO:0016020	0.416	membrane
GO:0032991	0.396	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]