StarFunc result for job id O75578

User Input

>input (1167 residues)
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA
AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ
RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ
KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT
SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC
SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT
EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL
VFCLWKLGFFAHKKIPEEEKREEKLEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K470	0.718	0.713	0.000	1178	0.350	0.346	A0A0G2K470.pdb.gz	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	AFDB:O75578	1.000	1.000	0.000	1167	1.000	1.000	O75578.pdb.gz	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	AFDB:P17301	0.618	0.611	0.000	1181	0.344	0.340	P17301.pdb.gz	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	AFDB:P18614	0.616	0.610	0.000	1180	0.358	0.354	P18614.pdb.gz	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	AFDB:P56199	0.626	0.621	0.000	1179	0.355	0.351	P56199.pdb.gz	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	AFDB:P61622	0.632	0.622	0.000	1188	0.440	0.432	P61622.pdb.gz	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	AFDB:Q9QYE7	0.551	0.554	7.278E-104	1161	0.288	0.289	Q9QYE7.pdb.gz	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
8	AFDB:Q13349	0.560	0.563	3.954E-103	1161	0.280	0.282	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
9	AFDB:Q9QXH4	0.551	0.550	1.022E-102	1169	0.272	0.271	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
10	AFDB:P11215	0.529	0.536	8.903E-102	1152	0.288	0.292	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
11	PDB:4nehA	0.449	0.480	1.567E-92	1084	0.255	0.275	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.448	0.489	1.127E-90	1063	0.251	0.276	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.422	0.566	2.790E-71	856	0.214	0.292	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:3k6sC	0.415	0.538	9.720E-64	885	0.207	0.272	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
15	PDB:4g1eA	0.424	0.505	9.286E-61	964	0.181	0.219	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
16	PDB:3fcsA	0.406	0.512	5.407E-59	913	0.171	0.218	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
17	PDB:7nxdA	0.430	0.546	9.858E-58	905	0.191	0.246	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:4rtdA	0.075	0.077	4.268E-10	1122	0.056	0.058	4rtdA.pdb.gz
19	PDB:7tvzE	0.093	0.143	6.300E-9	665	0.033	0.059	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
20	PDB:5a42A	0.091	0.077	8.203E-9	1597	0.061	0.044	5a42A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K470	0.0	689	1178	0.354	0.351	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	O75578	0.0	2392	1167	1.000	1.000	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	P17301	0.0	671	1181	0.348	0.344	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	P18614	0.0	720	1180	0.368	0.364	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	P56199	0.0	738	1179	0.367	0.363	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	P61622	0.0	934	1188	0.439	0.431	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	Q3V3R4	0.0	721	1179	0.368	0.365	ITA1_MOUSE Integrin alpha-1 OS=Mus musculus OX=10090 GN=Itga1 PE=1 SV=2
8	Q62469	0.0	687	1178	0.356	0.352	ITA2_MOUSE Integrin alpha-2 OS=Mus musculus OX=10090 GN=Itga2 PE=1 SV=2
9	Q9UKX5	0.0	944	1188	0.441	0.434	ITA11_HUMAN Integrin alpha-11 OS=Homo sapiens OX=9606 GN=ITGA11 PE=1 SV=2
10	Q9QYE7	2.08e-120	402	1161	0.302	0.304	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
11	Q13349	1.62e-117	394	1161	0.297	0.299	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
12	Q3V0T4	1.86e-117	394	1168	0.296	0.295	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
13	Q9QXH4	3.24e-113	382	1169	0.287	0.287	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
14	P24063	1.36e-112	380	1162	0.297	0.299	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
15	Q3T1L6	6.62e-112	379	1160	0.266	0.267	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
16	P20701	7.91e-112	379	1170	0.266	0.266	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
17	F1LP44	3.70e-111	377	1161	0.267	0.269	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
18	P11215	4.29e-111	376	1152	0.300	0.304	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
19	G3V8L7	1.49e-109	372	1151	0.290	0.294	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
20	A0A0G2K4L8	5.35e-109	370	1151	0.289	0.293	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	2.1e-19	80.2	FG-GAP repeat
2	PF14312 FG-GAP_2	3.7	19.2	FG-GAP repeat
3	PF13517 FG-GAP_3	0.0054	28.6	FG-GAP-like repeat
4	PF08441 Integrin_alpha2	1.7e-33	128.1	Integrin alpha
5	PF00092 VWA	7.5e-36	135.5	von Willebrand factor type A domain
6	PF13519 VWA_2	3.9e-06	38.8	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379350	0.972	Integrin beta-1
2	9606.ENSP00000283249	0.971	Integrin beta-6
3	9606.ENSP00000222573	0.969	Integrin beta-8
4	9606.ENSP00000296181	0.967	Integrin beta-5
5	9606.ENSP00000267082	0.966	Integrin beta-7
6	9606.ENSP00000452786	0.963	Integrin beta-3
7	9606.ENSP00000380948	0.959	Integrin beta-2
8	9606.ENSP00000007722	0.928	Integrin alpha-3
9	9606.ENSP00000200181	0.927	Integrin beta-4
10	9606.ENSP00000369889	0.924	Collagen alpha-1(II) chain
11	9606.ENSP00000261023	0.920	Integrin alpha-V
12	9606.ENSP00000373854	0.920	Integrin alpha-D
13	9606.ENSP00000293379	0.918	Integrin alpha-5
14	9606.ENSP00000367316	0.918	Integrin alpha-8
15	9606.ENSP00000380227	0.916	Integrin alpha-4
16	9606.ENSP00000282588	0.910	Integrin alpha-1
17	9606.ENSP00000296585	0.909	Integrin alpha-2
18	9606.ENSP00000327290	0.906	Integrin alpha-11
19	9606.ENSP00000349252	0.903	Integrin alpha-L
20	9606.ENSP00000298316	0.902	ADP-ribosylation factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	0.999	cell adhesion molecule binding
GO:0005518	0.999	collagen binding
GO:0098631	0.965	cell adhesion mediator activity
GO:0005102	0.485	signaling receptor binding
GO:0098634	0.391	cell-matrix adhesion mediator activity
GO:0005178	0.334	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007155	0.993	cell adhesion
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.953	response to stimulus
GO:0007160	0.942	cell-matrix adhesion
GO:0051716	0.882	cellular response to stimulus
GO:0007229	0.873	integrin-mediated signaling pathway
GO:0032501	0.659	multicellular organismal process
GO:0032502	0.503	developmental process
GO:0048856	0.471	anatomical structure development
GO:0048518	0.364	positive regulation of biological process
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008305	0.996	integrin complex
GO:0031982	0.874	vesicle
GO:0005576	0.787	extracellular region
GO:0043231	0.745	intracellular membrane-bounded organelle
GO:0005615	0.727	extracellular space
GO:0005737	0.651	cytoplasm
GO:0009986	0.637	cell surface
GO:0030054	0.400	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]