StarFunc result for job id O75581

User Input

>input (1613 residues)
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
SHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWT
DWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K0H3	0.879	0.879	0.000	1613	0.984	0.984	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
2	AFDB:O75197	0.807	0.806	0.000	1615	0.699	0.698	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
3	AFDB:Q9VXM0	0.413	0.340	0.000	2009	0.319	0.256	Q9VXM0.pdb.gz	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
4	AFDB:A0A2R8PYI8	0.224	0.333	1.287E-87	968	0.219	0.366	A0A2R8PYI8.pdb.gz	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
5	AFDB:A8JRD0	0.188	0.281	2.733E-34	1076	0.082	0.124	A8JRD0.pdb.gz	A8JRD0_DROME Lipophorin receptor 1, isoform K OS=Drosophila melanogaster OX=7227 GN=LpR1 PE=4 SV=2
6	AFDB:Q9VBN2	0.188	0.293	1.318E-33	1028	0.082	0.128	Q9VBN2.pdb.gz	Q9VBN2_DROME Lipophorin receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=4
7	AFDB:Q98931	0.183	0.319	1.384E-33	917	0.077	0.136	Q98931.pdb.gz	LRP8_CHICK Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus OX=9031 GN=LRP8 PE=1 SV=1
8	AFDB:D3ZE75	0.182	0.305	3.192E-33	953	0.083	0.141	D3ZE75.pdb.gz	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
9	AFDB:Q7YU01	0.188	0.284	5.482E-33	1064	0.082	0.124	Q7YU01.pdb.gz	Q7YU01_DROME LD11117p OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=2 SV=1
10	AFDB:P35951	0.186	0.345	1.698E-32	862	0.069	0.130	P35951.pdb.gz	LDLR_MOUSE Low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Ldlr PE=1 SV=2
11	PDB:6jp6A	0.120	0.182	1.285E-19	998	0.069	0.111	6jp6A.pdb.gz
12	PDB:7mq8LO	0.110	0.187	2.031E-17	848	0.042	0.079	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:1n6dA	0.081	0.119	2.728E-17	1023	0.050	0.079	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
14	PDB:7mq8LT	0.108	0.192	5.430E-17	869	0.052	0.097	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7mq8LR	0.119	0.230	1.856E-16	773	0.043	0.091	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5hxbY	0.105	0.150	2.150E-16	1080	0.070	0.105	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
17	PDB:1nr0A	0.161	0.352	4.074E-16	610	0.042	0.111	1nr0A.pdb.gz
18	PDB:2hyeA	0.105	0.142	4.279E-16	1140	0.080	0.113	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
19	PDB:7ajuUL	0.090	0.172	4.959E-16	779	0.043	0.090	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:6lqsB1	0.111	0.203	5.747E-16	806	0.051	0.103	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFD1	638	4752	0.275	0.093	A0A0B4KFD1_DROME LDL receptor protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=1
2	A0A0G2K0H3	3320	1613	0.985	0.985	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
3	A0A8I6AQY2	749	4469	0.290	0.105	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
4	A0A8I6G721	2220	1560	0.682	0.705	A0A8I6G721_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=3 SV=1
5	A1Z7C4	639	4730	0.275	0.094	A1Z7C4_DROME LDL receptor protein 1, isoform G OS=Drosophila melanogaster OX=7227 GN=LRP1 PE=1 SV=2
6	A1Z9D7	1285	1678	0.427	0.411	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
7	A2ARV4	667	4660	0.291	0.101	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
8	A8JTM7	656	4769	0.282	0.095	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
9	B2RYI1	2260	1600	0.692	0.698	B2RYI1_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=2 SV=1
10	B5L5I6	2737	1620	0.815	0.812	B5L5I6_DANRE Low-density lipoprotein receptor-related protein OS=Danio rerio OX=7955 GN=lrp6 PE=1 SV=1
11	C0HL13	673	4652	0.285	0.099	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
12	D0EWS1	2019	1430	0.614	0.692	D0EWS1_DANRE Low density lipoprotein-related protein 6 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
13	E0AE56	662	4673	0.291	0.101	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
14	E1BGJ0	806	4545	0.312	0.111	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
15	F1M443	749	4436	0.290	0.106	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
16	F1MAD0	2157	1473	0.630	0.690	F1MAD0_RAT LDL receptor related protein 5 OS=Rattus norvegicus OX=10116 GN=Lrp5 PE=4 SV=3
17	F1QTJ4	2247	1615	0.684	0.683	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
18	F1QY34	817	4549	0.303	0.107	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
19	G3V928	804	4545	0.310	0.110	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
20	O75096	1099	1905	0.343	0.290	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01731 Arylesterase	0.0074	27.8	Arylesterase
2	PF12662 cEGF	2.5	19.4	Complement Clr-like EGF-like
3	PF16472 DUF5050	3.9e-17	73.9	Domain of unknown function (DUF5050)
4	PF14670 FXa_inhibition	3.7e-31	118.5	Coagulation Factor Xa inhibitory site
5	PF00057 Ldl_recept_a	2.4e-28	109.4	Low-density lipoprotein receptor domain class A
6	PF00058 Ldl_recept_b	1.4e-151	504.0	Low-density lipoprotein receptor repeat class B
7	PF01436 NHL	12	17.3	NHL repeat
8	PF08450 SGL	2.6e-13	61.8	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.999	Axin-1
2	9606.ENSP00000284523	0.999	Protein Wnt-3a
3	9606.ENSP00000301691	0.999	Sclerostin
4	9606.ENSP00000363081	0.999	Dickkopf-related protein 1
5	9606.ENSP00000285311	0.998	Dickkopf-related protein 2
6	9606.ENSP00000293549	0.998	Proto-oncogene Wnt-1
7	9606.ENSP00000368169	0.998	Segment polarity protein dishevelled homolog DVL-1
8	9606.ENSP00000264634	0.997	Protein Wnt-5a
9	9606.ENSP00000344456	0.997	Catenin beta-1
10	9606.ENSP00000339191	0.996	Caveolin-1
11	9606.ENSP00000348944	0.996	R-spondin-1
12	9606.ENSP00000363826	0.996	Frizzled-8
13	9606.ENSP00000304422	0.995	Kremen protein 2
14	9606.ENSP00000324806	0.994	Glycogen synthase kinase-3 beta
15	9606.ENSP00000005340	0.992	Segment polarity protein dishevelled homolog DVL-2
16	9606.ENSP00000331242	0.992	Kremen protein 1
17	9606.ENSP00000354607	0.992	Frizzled-5
18	9606.ENSP00000434034	0.991	Frizzled-4
19	9606.ENSP00000261758	0.990	LRP chaperone MESD
20	9606.ENSP00000321999	0.988	Parathyroid hormone/parathyroid hormone-related peptide receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	0.998	Wnt-protein binding
GO:0038023	0.997	signaling receptor activity
GO:0042813	0.991	Wnt receptor activity
GO:0015026	0.989	coreceptor activity
GO:0071936	0.747	coreceptor activity involved in Wnt signaling pathway
GO:0019534	0.353	toxin transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.981	anatomical structure development
GO:0051716	0.974	cellular response to stimulus
GO:0048731	0.968	system development
GO:0048513	0.958	animal organ development
GO:0019222	0.953	regulation of metabolic process
GO:0080090	0.930	regulation of primary metabolic process
GO:0009893	0.904	positive regulation of metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0009653	0.897	anatomical structure morphogenesis
GO:0007154	0.881	cell communication
GO:0023052	0.878	signaling
GO:0007165	0.871	signal transduction
GO:0048522	0.841	positive regulation of cellular process
GO:0048519	0.824	negative regulation of biological process
GO:0042221	0.823	response to chemical
GO:0048863	0.816	stem cell differentiation
GO:0060255	0.814	regulation of macromolecule metabolic process
GO:0007166	0.813	cell surface receptor signaling pathway
GO:0048762	0.811	mesenchymal cell differentiation
GO:0048523	0.769	negative regulation of cellular process
GO:0048583	0.760	regulation of response to stimulus
GO:0007267	0.751	cell-cell signaling
GO:0010468	0.748	regulation of gene expression
GO:0051171	0.747	regulation of nitrogen compound metabolic process
GO:0023051	0.734	regulation of signaling
GO:0010604	0.729	positive regulation of macromolecule metabolic process
GO:0010646	0.722	regulation of cell communication
GO:0016055	0.716	Wnt signaling pathway
GO:0009889	0.710	regulation of biosynthetic process
GO:0007399	0.703	nervous system development
GO:0065009	0.698	regulation of molecular function
GO:0006355	0.695	regulation of DNA-templated transcription
GO:0042127	0.691	regulation of cell population proliferation
GO:0050793	0.686	regulation of developmental process
GO:1901700	0.674	response to oxygen-containing compound
GO:0060070	0.664	canonical Wnt signaling pathway
GO:0060429	0.662	epithelium development
GO:0051174	0.650	regulation of phosphorus metabolic process
GO:0009719	0.648	response to endogenous stimulus
GO:0010033	0.647	response to organic substance
GO:0051173	0.630	positive regulation of nitrogen compound metabolic process
GO:0043009	0.625	chordate embryonic development
GO:0048732	0.617	gland development
GO:0009966	0.614	regulation of signal transduction
GO:0048598	0.602	embryonic morphogenesis
GO:0051246	0.596	regulation of protein metabolic process
GO:0001501	0.556	skeletal system development
GO:0031325	0.487	positive regulation of cellular metabolic process
GO:0010243	0.465	response to organonitrogen compound
GO:0008152	0.453	metabolic process
GO:0009887	0.390	animal organ morphogenesis
GO:0072359	0.384	circulatory system development
GO:0030111	0.379	regulation of Wnt signaling pathway
GO:0043434	0.369	response to peptide hormone
GO:0048880	0.353	sensory system development
GO:0007423	0.344	sensory organ development
GO:0009892	0.326	negative regulation of metabolic process
GO:0045935	0.319	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.317	positive regulation of macromolecule biosynthetic process
GO:0031328	0.314	positive regulation of cellular biosynthetic process
GO:0051239	0.306	regulation of multicellular organismal process
GO:0051254	0.300	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005576	0.975	extracellular region
GO:0031982	0.933	vesicle
GO:0032991	0.925	protein-containing complex
GO:0031410	0.924	cytoplasmic vesicle
GO:0031090	0.920	organelle membrane
GO:0098588	0.751	bounding membrane of organelle
GO:0012506	0.751	vesicle membrane
GO:0030659	0.734	cytoplasmic vesicle membrane
GO:0005768	0.607	endosome
GO:0005615	0.596	extracellular space
GO:0098796	0.551	membrane protein complex
GO:0005769	0.477	early endosome
GO:0005829	0.442	cytosol
GO:0070013	0.412	intracellular organelle lumen
GO:0065010	0.386	extracellular membrane-bounded organelle
GO:0030054	0.385	cell junction
GO:0005634	0.358	nucleus
GO:0005739	0.350	mitochondrion
GO:0009986	0.339	cell surface
GO:0043025	0.330	neuronal cell body
GO:0031981	0.325	nuclear lumen
GO:0098590	0.309	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]