StarFunc result for job id O75582

User Input

>input (802 residues)
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75582	1.000	1.000	0.000	802	1.000	1.000	O75582.pdb.gz	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
2	AFDB:Q8C050	0.765	0.717	0.000	863	0.963	0.895	Q8C050.pdb.gz	KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus OX=10090 GN=Rps6ka5 PE=1 SV=2
3	AFDB:Q9Z2B9	0.420	0.435	1.570E-84	773	0.613	0.636	Q9Z2B9.pdb.gz	KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus OX=10090 GN=Rps6ka4 PE=1 SV=2
4	AFDB:A0A0R4ID09	0.372	0.405	3.511E-56	733	0.388	0.424	A0A0R4ID09.pdb.gz	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
5	AFDB:A0A384MDW3	0.359	0.388	9.843E-56	740	0.384	0.416	A0A384MDW3.pdb.gz	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q15349	0.374	0.408	1.432E-55	733	0.384	0.420	Q15349.pdb.gz	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
7	AFDB:Q15418	0.374	0.406	2.760E-55	735	0.380	0.415	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
8	AFDB:Q9UK32	0.364	0.391	6.722E-55	745	0.398	0.428	Q9UK32.pdb.gz	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1
9	AFDB:Q7TPS0	0.360	0.377	3.964E-53	764	0.385	0.404	Q7TPS0.pdb.gz	KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus OX=10090 GN=Rps6ka6 PE=1 SV=2
10	AFDB:A0A2R8Q8Y4	0.412	0.470	9.213E-53	685	0.370	0.434	A0A2R8Q8Y4.pdb.gz
11	PDB:6s9wA	0.326	0.612	9.047E-24	411	0.176	0.343	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
12	PDB:6hhgA	0.316	0.632	6.179E-23	386	0.166	0.345	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
13	PDB:6byrA	0.323	0.625	1.505E-22	405	0.146	0.289	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:5u6yA	0.318	0.545	2.190E-22	459	0.140	0.244	5u6yA.pdb.gz
15	PDB:5kcvA	0.304	0.671	8.133E-22	353	0.148	0.337	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
16	PDB:3pvuA	0.318	0.414	1.981E-21	609	0.157	0.207	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:4mk0A	0.322	0.404	9.301E-21	631	0.148	0.189	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:6pjxA	0.333	0.484	1.793E-20	543	0.135	0.199	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
19	PDB:5x3fB	0.294	0.650	1.969E-20	349	0.136	0.312	5x3fB.pdb.gz
20	PDB:3pfqA	0.324	0.490	2.374E-20	523	0.150	0.229	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YYC0	974	704	0.592	0.675	A0A0A6YYC0_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=5
2	A0A0R4ID09	574	733	0.398	0.435	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
3	A0A384MDW3	568	740	0.390	0.423	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
4	B4DG22	566	711	0.390	0.440	B4DG22_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
5	B7ZB17	568	712	0.390	0.440	B7ZB17_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
6	E9PGT3	555	724	0.387	0.428	E9PGT3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=1
7	E9PJN1	993	765	0.611	0.641	E9PJN1_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=1
8	O75582	1669	802	1.000	1.000	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
9	O75676	1012	772	0.617	0.641	KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=1
10	P18653	556	724	0.385	0.427	KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus OX=10090 GN=Rps6ka1 PE=1 SV=1
11	P18654	568	740	0.397	0.430	KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus OX=10090 GN=Rps6ka3 PE=1 SV=2
12	P51812	568	740	0.390	0.423	KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
13	Q15349	566	733	0.385	0.422	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
14	Q15418	575	735	0.394	0.430	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
15	Q63531	575	735	0.393	0.429	KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus OX=10116 GN=Rps6ka1 PE=1 SV=1
16	Q7TPS0	546	764	0.397	0.416	KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus OX=10090 GN=Rps6ka6 PE=1 SV=2
17	Q7ZVH8	573	732	0.397	0.434	Q7ZVH8_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=rps6ka3 PE=1 SV=1
18	Q8C050	625	863	0.370	0.344	KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus OX=10090 GN=Rps6ka5 PE=1 SV=2
19	Q9PTN1	560	737	0.395	0.430	Q9PTN1_XENLA Ribosomal protein S6 kinase OS=Xenopus laevis OX=8355 GN=rps6ka3.L PE=1 SV=1
20	Q9UK32	552	745	0.394	0.424	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2e-08	45.2	ABC1 atypical kinase-like domain
2	PF01636 APH	6.6e-06	37.7	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	6.2	17.9	Choline/ethanolamine kinase
4	PF13095 FTA2	0.022	26.0	Kinetochore Sim4 complex subunit FTA2
5	PF12330 Haspin_kinase	0.13	22.7	Haspin like kinase domain
6	PF06293 Kdo	1.1e-07	43.0	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	1.8e-09	48.9	Kinase-like
8	PF00069 Pkinase	7.8e-140	476.3	Protein kinase domain
9	PF00433 Pkinase_C	2e-05	36.5	Protein kinase C terminal domain
10	PF17667 Pkinase_fungal	0.00013	32.5	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	2.4e-63	225.4	Protein tyrosine and serine/threonine kinase
12	PF01163 RIO1	0.011	26.8	RIO1 family
13	PF10500 SR-25	1.7e+02	13.1	Nuclear RNA-splicing-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000015644

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000002656	0.989	cAMP responsive element binding protein 1
2	9555.ENSPANP00000012362	0.983	Activating transcription factor 6 beta
3	9555.ENSPANP00000012511	0.981	Mitogen-activated protein kinase 14
4	9555.ENSPANP00000018400	0.977	Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA- 3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA- 3')
5	9555.ENSPANP00000012514	0.970	Mitogen-activated protein kinase 13
6	9555.ENSPANP00000015923	0.967	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
7	9555.ENSPANP00000013664	0.966	Mitogen-activated protein kinase 12
8	9555.ENSPANP00000013369	0.953	Activating transcription factor 4
9	9555.ENSPANP00000010934	0.950	cAMP responsive element binding protein 3-like 2
10	9555.ENSPANP00000002630	0.948	cAMP responsive element binding protein 5
11	9555.ENSPANP00000012509	0.946	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
12	9555.ENSPANP00000006837	0.934	cAMP responsive element binding protein 3-like 1
13	9555.ENSPANP00000013665	0.933	Mitogen-activated protein kinase 11
14	9555.ENSPANP00000009798	0.867	Activating transcription factor 1
15	9555.ENSPANP00000010193	0.863	Ribosomal protein S6 kinase, 90kDa, polypeptide 4
16	9555.ENSPANP00000017839	0.855	Eukaryotic translation initiation factor 4E binding protein 1
17	9555.ENSPANP00000006630	0.818	RELA proto-oncogene, NF-kB subunit
18	9555.ENSPANP00000020581	0.747	Male-specific lethal 1 homolog (Drosophila)
19	9555.ENSPANP00000020140	0.731	cAMP responsive element modulator
20	9555.ENSPANP00000004582	0.727	MSL complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0043168	0.996	anion binding
GO:0005524	0.991	ATP binding
GO:0019899	0.312	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0050896	0.982	response to stimulus
GO:0071704	0.946	organic substance metabolic process
GO:0044237	0.946	cellular metabolic process
GO:0016310	0.940	phosphorylation
GO:0044238	0.933	primary metabolic process
GO:0023052	0.925	signaling
GO:0043170	0.924	macromolecule metabolic process
GO:0006807	0.923	nitrogen compound metabolic process
GO:0006468	0.907	protein phosphorylation
GO:0007154	0.891	cell communication
GO:0051716	0.887	cellular response to stimulus
GO:0006355	0.863	regulation of DNA-templated transcription
GO:0048518	0.858	positive regulation of biological process
GO:0048522	0.790	positive regulation of cellular process
GO:0007165	0.761	signal transduction
GO:0035556	0.714	intracellular signal transduction
GO:0009893	0.702	positive regulation of metabolic process
GO:0010604	0.680	positive regulation of macromolecule metabolic process
GO:0048519	0.520	negative regulation of biological process
GO:0031325	0.497	positive regulation of cellular metabolic process
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0042221	0.448	response to chemical
GO:0048523	0.431	negative regulation of cellular process
GO:0010557	0.426	positive regulation of macromolecule biosynthetic process
GO:0031328	0.403	positive regulation of cellular biosynthetic process
GO:0071840	0.397	cellular component organization or biogenesis
GO:0032501	0.387	multicellular organismal process
GO:0051254	0.376	positive regulation of RNA metabolic process
GO:0045893	0.372	positive regulation of DNA-templated transcription
GO:0070887	0.367	cellular response to chemical stimulus
GO:0065009	0.365	regulation of molecular function
GO:0006357	0.362	regulation of transcription by RNA polymerase II
GO:0009892	0.326	negative regulation of metabolic process
GO:0010605	0.302	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.957	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]