StarFunc result for job id O75586

User Input

>input (246 residues)
MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHL
NQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVL
TAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDAL
LLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPE
KRMRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WYL7	0.583	0.559	2.099E-39	257	0.996	0.953	A0A087WYL7.pdb.gz	A0A087WYL7_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=1
2	PDB:7emfF	0.500	0.703	6.561E-25	167	0.679	1.000	7emfF.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:Q8MSX2	0.588	0.581	3.648E-24	249	0.451	0.446	Q8MSX2.pdb.gz	MED6_DROME Mediator of RNA polymerase II transcription subunit 6 OS=Drosophila melanogaster OX=7227 GN=MED6 PE=1 SV=1
4	AFDB:Q9N337	0.608	0.599	2.628E-18	250	0.337	0.332	Q9N337.pdb.gz	MED6_CAEEL Mediator of RNA polymerase II transcription subunit 6 OS=Caenorhabditis elegans OX=6239 GN=mdt-6 PE=1 SV=1
5	AFDB:Q9US45	0.542	0.611	2.167E-15	216	0.244	0.278	Q9US45.pdb.gz	MED6_SCHPO Mediator of RNA polymerase II transcription subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med6 PE=1 SV=1
6	AFDB:F4IXJ7	0.482	0.402	6.198E-15	298	0.321	0.265	F4IXJ7.pdb.gz	MED6_ARATH Mediator of RNA polymerase II transcription subunit 6 OS=Arabidopsis thaliana OX=3702 GN=MED6 PE=1 SV=1
7	PDB:5n9jS	0.465	0.638	5.761E-13	171	0.215	0.310	5n9jS.pdb.gz
8	PDB:5u0pF	0.488	0.601	1.305E-12	195	0.207	0.262	5u0pF.pdb.gz
9	AFDB:P38782	0.505	0.427	3.122E-11	295	0.268	0.224	P38782.pdb.gz	MED6_YEAST Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED6 PE=1 SV=1
10	PDB:5oqma	0.424	0.650	6.359E-10	149	0.207	0.342	5oqma.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
11	PDB:4gwqG	0.322	0.426	1.972E-3	170	0.159	0.229	4gwqG.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
12	PDB:6qldN	0.128	0.093	1.987E-1	371	0.041	0.027	6qldN.pdb.gz	Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
13	AFDB:Q9QZA1	0.125	0.091	2.567E-1	407	0.114	0.069	Q9QZA1.pdb.gz	PHLA1_RAT Pleckstrin homology-like domain family A member 1 OS=Rattus norvegicus OX=10116 GN=Phlda1 PE=2 SV=2
14	AFDB:P41848	0.095	0.052	2.721E-1	697	0.077	0.027	P41848.pdb.gz	SSP1A_CAEEL FACT complex subunit SSRP1-A OS=Caenorhabditis elegans OX=6239 GN=hmg-4 PE=1 SV=1
15	PDB:2p0mA	0.111	0.049	3.777E-1	662	0.033	0.012	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
16	AFDB:Q57VM8	0.133	0.068	4.095E-1	562	0.098	0.043	Q57VM8.pdb.gz	Q57VM8_TRYB2 PIH1D1/2/3 CS-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.460 PE=4 SV=1
17	PDB:4it3A	0.094	0.105	4.245E-1	219	0.049	0.055	4it3A.pdb.gz
18	AFDB:F8W338	0.093	0.057	4.602E-1	439	0.098	0.055	F8W338.pdb.gz
19	PDB:6ppnD	0.096	0.225	5.362E-1	88	0.053	0.148	6ppnD.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
20	PDB:7lt3F	0.137	0.150	5.362E-1	213	0.077	0.089	7lt3F.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYL7	0.0	508	257	0.996	0.953	A0A087WYL7_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=1
2	G3V4A5	0.0	511	249	1.000	0.988	G3V4A5_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=1
3	O75586	0.0	510	246	1.000	1.000	MED6_HUMAN Mediator of RNA polymerase II transcription subunit 6 OS=Homo sapiens OX=9606 GN=MED6 PE=1 SV=2
4	Q921D4	9.61e-179	492	246	0.951	0.951	MED6_MOUSE Mediator of RNA polymerase II transcription subunit 6 OS=Mus musculus OX=10090 GN=Med6 PE=1 SV=2
5	A0A8I6ALZ8	4.53e-169	468	247	0.915	0.911	A0A8I6ALZ8_RAT Mediator of RNA polymerase II transcription subunit 6 OS=Rattus norvegicus OX=10116 GN=Med6 PE=3 SV=1
6	A0A8I6GLU7	7.78e-169	467	242	0.915	0.930	A0A8I6GLU7_RAT Mediator of RNA polymerase II transcription subunit 6 OS=Rattus norvegicus OX=10116 GN=Med6 PE=3 SV=1
7	A0A8I6AVM6	1.73e-116	333	196	0.638	0.801	A0A8I6AVM6_RAT Mediator of RNA polymerase II transcription subunit 6 OS=Rattus norvegicus OX=10116 GN=Med6 PE=3 SV=1
8	Q8MSX2	1.42e-74	228	249	0.463	0.458	MED6_DROME Mediator of RNA polymerase II transcription subunit 6 OS=Drosophila melanogaster OX=7227 GN=MED6 PE=1 SV=1
9	Q9N337	1.09e-34	126	250	0.305	0.300	MED6_CAEEL Mediator of RNA polymerase II transcription subunit 6 OS=Caenorhabditis elegans OX=6239 GN=mdt-6 PE=1 SV=1
10	F4IXJ7	1.73e-30	116	298	0.240	0.198	MED6_ARATH Mediator of RNA polymerase II transcription subunit 6 OS=Arabidopsis thaliana OX=3702 GN=MED6 PE=1 SV=1
11	Q9US45	1.71e-20	88.6	216	0.199	0.227	MED6_SCHPO Mediator of RNA polymerase II transcription subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med6 PE=1 SV=1
12	P38782	2.51e-18	84.0	295	0.228	0.190	MED6_YEAST Mediator of RNA polymerase II transcription subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED6 PE=1 SV=1
13	P32657	1.8	32.3	1468	0.106	0.018	CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHD1 PE=1 SV=1
14	Q86WV5	1.9	30.8	123	0.053	0.106	TEN1L_HUMAN CST complex subunit TEN1 OS=Homo sapiens OX=9606 GN=TEN1 PE=1 SV=2
15	Q80XN0	2.4	31.6	343	0.065	0.047	BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Bdh1 PE=1 SV=2
16	P29147	2.5	31.6	343	0.065	0.047	BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bdh1 PE=1 SV=2
17	P47130	5.1	30.8	423	0.102	0.059	CSN12_YEAST Cop9 signalosome complex subunit 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSN12 PE=1 SV=1
18	Q9I3K2	7.2	30.4	569	0.085	0.037	Q9I3K2_PSEAE Alpha/beta hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1510 PE=1 SV=1
19	Q92904	9.1	29.6	295	0.069	0.058	DAZL_HUMAN Deleted in azoospermia-like OS=Homo sapiens OX=9606 GN=DAZL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04934 Med6	1.3e-39	146.5	MED6 mediator sub complex component
2	PF01427 Peptidase_M15	13	17.0	D-ala-D-ala dipeptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000006770

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017124	0.994	Mediator of RNA polymerase II transcription subunit 10
2	9601.ENSPPYP00000004996	0.992	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
3	9601.ENSPPYP00000022666	0.991	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	9601.ENSPPYP00000017887	0.986	Uncharacterized protein
5	9601.ENSPPYP00000005956	0.978	Cyclin-dependent kinase 8
6	9601.ENSPPYP00000006099	0.978	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
7	9601.ENSPPYP00000004320	0.972	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	9601.ENSPPYP00000009539	0.970	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Acts as a coactivator for GATA1- mediated transcriptional activation during eryt [...]
9	9601.ENSPPYP00000018878	0.968	Uncharacterized protein
10	9601.ENSPPYP00000018572	0.964	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
11	9601.ENSPPYP00000011155	0.962	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
12	9601.ENSPPYP00000003751	0.959	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	9601.ENSPPYP00000021132	0.959	Mediator complex subunit 30
14	9601.ENSPPYP00000016341	0.958	Mediator complex subunit 28
15	9601.ENSPPYP00000008911	0.956	DNA-directed RNA polymerase subunit
16	9601.ENSPPYP00000009885	0.956	Mediator of RNA polymerase II transcription subunit 13
17	9601.ENSPPYP00000011489	0.956	Mediator complex subunit 25
18	9601.ENSPPYP00000001898	0.954	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
19	9601.ENSPPYP00000022889	0.953	Mediator of RNA polymerase II transcription subunit 12
20	9601.ENSPPYP00000008827	0.945	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0061630	0.995	ubiquitin protein ligase activity
GO:0003712	0.979	transcription coregulator activity
GO:0003713	0.968	transcription coactivator activity
GO:0008134	0.657	transcription factor binding
GO:0001223	0.310	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:1901564	0.916	organonitrogen compound metabolic process
GO:0065007	0.913	biological regulation
GO:0019538	0.910	protein metabolic process
GO:0050789	0.904	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0019222	0.863	regulation of metabolic process
GO:0036211	0.860	protein modification process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0080090	0.845	regulation of primary metabolic process
GO:0051171	0.845	regulation of nitrogen compound metabolic process
GO:0031323	0.844	regulation of cellular metabolic process
GO:0010468	0.841	regulation of gene expression
GO:0048518	0.828	positive regulation of biological process
GO:0019219	0.823	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.813	regulation of macromolecule biosynthetic process
GO:0031326	0.813	regulation of cellular biosynthetic process
GO:0051252	0.813	regulation of RNA metabolic process
GO:0070647	0.812	protein modification by small protein conjugation or removal
GO:0006355	0.768	regulation of DNA-templated transcription
GO:0006357	0.727	regulation of transcription by RNA polymerase II
GO:0010604	0.705	positive regulation of macromolecule metabolic process
GO:0048522	0.702	positive regulation of cellular process
GO:0051173	0.695	positive regulation of nitrogen compound metabolic process
GO:0031325	0.693	positive regulation of cellular metabolic process
GO:0016567	0.691	protein ubiquitination
GO:0045935	0.681	positive regulation of nucleobase-containing compound metabolic process
GO:0045944	0.669	positive regulation of transcription by RNA polymerase II
GO:0009987	0.411	cellular process
GO:0044237	0.332	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:1990234	0.946	transferase complex
GO:0140535	0.937	intracellular protein-containing complex
GO:0140513	0.897	nuclear protein-containing complex
GO:0090575	0.749	RNA polymerase II transcription regulator complex
GO:0070847	0.529	core mediator complex
GO:0016592	0.354	mediator complex
GO:0005737	0.304	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.995	Transferases.

[back to server]