StarFunc result for job id O75592

User Input

>input (1400 residues)
MMMCAATASPAAASSGLGGDGFYPAATFSSSPAPGALFMPVPDGSVAAAGLGLGLPAADS
RGHYQLLLSGRALADRYRRIYTAALNDRDQGGGSAGHPASRNKKILNKKKLKRKQKSKSK
VKTRSKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCVLEWQKKEISLAAASKNSVQSGE
SDSDEEEESKEPPIKLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEG
LQSEPPEVLESLFQLLLEITVRSTGMNDSTGQSLTALSCACLFSLVASWGETGRTLQAIS
AILTNNGSHACQTIQVPTILNSLQRSVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEIS
VDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGYAQ
GYLLYRDVNNHSMTAIRISPETLEQDGTVMLPDCHTEGQNILFTDGEYINQIAASRDDGF
VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAGREF
ALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITKSPKIVHFSVGHDGSHALLVAED
GSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELY
MFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGAM
NQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGMHKWKLEQCMVCTVCGDCTGYGA
SCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACARELDGQEARQRGILDAVKEMIPLDL
LLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLEEGRGPLVFAGPIFMNHREQALARLRSH
PAQLKHKRDKHKDGSGERGEKDASKITTYPPGSVRFDCELRAVQVSCGFHHSVVLMENGD
VYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSK
GQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSEI
FASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGFGVCLDPVYDVIWRF
RPNTRELWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLD
TLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADT
DILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFD
EPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIP
QLLYRLPTSDGSASKGKQQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BNF7	0.226	0.262	4.320E-23	1203	0.103	0.120	Q8BNF7.pdb.gz	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
2	AFDB:Q5DX34	0.203	0.204	3.216E-19	1386	0.085	0.086	Q5DX34.pdb.gz	RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans OX=6239 GN=glo-4 PE=1 SV=2
3	AFDB:Q8VE37	0.221	0.694	2.307E-18	421	0.058	0.192	Q8VE37.pdb.gz	RCC1_MOUSE Regulator of chromosome condensation OS=Mus musculus OX=10090 GN=Rcc1 PE=1 SV=1
4	PDB:8gqeB	0.211	0.720	5.155E-18	386	0.054	0.194	8gqeB.pdb.gz
5	AFDB:Q9M2S1	0.221	0.599	3.139E-17	488	0.068	0.195	Q9M2S1.pdb.gz	Q9M2S1_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=TCF1 PE=1 SV=1
6	PDB:5tbkI	0.221	0.692	4.968E-17	419	0.057	0.191	5tbkI.pdb.gz
7	AFDB:F1QM29	0.227	0.225	1.130E-16	1413	0.064	0.064	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
8	AFDB:Q8I418	0.122	0.070	1.518E-16	2606	0.093	0.050	Q8I418.pdb.gz	Q8I418_PLAF7 Guanidine nucleotide exchange factor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0508500 PE=4 SV=1
9	PDB:5t94A	0.224	0.652	4.789E-16	454	0.046	0.143	5t94A.pdb.gz
10	PDB:5xgsA	0.216	0.711	1.415E-15	398	0.059	0.209	5xgsA.pdb.gz
11	AFDB:D6XFK1	0.184	0.453	1.943E-12	542	0.054	0.138	D6XFK1.pdb.gz	D6XFK1_TRYB2 Regulator of chromosome condensation OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1300 PE=4 SV=1
12	PDB:7mq8LR	0.074	0.122	1.602E-9	773	0.064	0.116	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6lqsBE	0.080	0.123	1.683E-9	823	0.053	0.090	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:4d4oA	0.179	0.555	5.766E-9	414	0.049	0.167	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
15	PDB:5wyjBE	0.080	0.137	1.622E-8	753	0.054	0.100	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:7d4iBE	0.075	0.111	2.075E-8	890	0.054	0.085	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:6ttuT	0.105	0.274	3.567E-8	394	0.039	0.137	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
18	AFDB:O13286	0.077	0.163	9.176E-6	556	0.056	0.140	O13286.pdb.gz	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1
19	AFDB:F8W3V6	0.083	0.095	2.018E-5	1193	0.084	0.099	F8W3V6.pdb.gz
20	AFDB:Q8C092	0.073	0.120	8.419E-5	801	0.062	0.109	Q8C092.pdb.gz	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FJI4	0.0	2920	4738	1.000	0.295	A0A499FJI4_HUMAN RCR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=2
2	F1RD40	0.0	2341	4574	0.824	0.252	MYCB2_DANRE E3 ubiquitin-protein ligase MYCBP2 OS=Danio rerio OX=7955 GN=mycbp2 PE=2 SV=1
3	O75592	0.0	2919	4678	1.000	0.299	MYCB2_HUMAN E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4
4	Q7TPH6	0.0	2874	4749	0.979	0.289	MYCB2_MOUSE E3 ubiquitin-protein ligase MYCBP2 OS=Mus musculus OX=10090 GN=Mycbp2 PE=1 SV=3
5	Q9NB71	9.23e-146	496	5233	0.244	0.065	HIW_DROME E3 ubiquitin-protein ligase highwire OS=Drosophila melanogaster OX=7227 GN=hiw PE=1 SV=2
6	Q17551	3.55e-95	342	3766	0.226	0.084	RPM1_CAEEL E3 ubiquitin-protein ligase rpm-1 OS=Caenorhabditis elegans OX=6239 GN=rpm-1 PE=1 SV=1
7	Q6IS59	6.12e-14	74.7	209	0.036	0.244	Q6IS59_MOUSE Btbd2 protein (Fragment) OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=1
8	Q91YK4	6.31e-14	74.7	218	0.036	0.234	Q91YK4_MOUSE Btbd2 protein (Fragment) OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=2
9	Q14BP3	4.50e-13	75.1	377	0.036	0.135	Q14BP3_MOUSE Btbd2 protein OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=1
10	Q14BP4	5.10e-13	74.7	377	0.036	0.135	Q14BP4_MOUSE Btbd2 protein OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=1
11	Q5XJI1	5.11e-13	74.7	361	0.036	0.141	Q5XJI1_MOUSE Btbd2 protein (Fragment) OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=1
12	Q7TNF6	7.33e-13	74.3	392	0.036	0.130	Q7TNF6_MOUSE Btbd2 protein (Fragment) OS=Mus musculus OX=10090 GN=Btbd2 PE=2 SV=1
13	Q9BX70	1.63e-12	74.3	525	0.036	0.097	BTBD2_HUMAN BTB/POZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BTBD2 PE=1 SV=1
14	E9PY28	1.73e-12	73.9	508	0.036	0.100	E9PY28_MOUSE BTB (POZ) domain containing 2 OS=Mus musculus OX=10090 GN=Btbd2 PE=1 SV=1
15	Q9VEL0	3.30e-12	73.6	677	0.036	0.075	Q9VEL0_DROME FI18038p1 OS=Drosophila melanogaster OX=7227 GN=lute PE=2 SV=1
16	A0A0B4KGU2	3.67e-12	73.6	735	0.036	0.069	A0A0B4KGU2_DROME Lute, isoform D OS=Drosophila melanogaster OX=7227 GN=lute PE=4 SV=1
17	E9PZP8	4.59e-12	73.9	4859	0.028	0.008	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
18	Q15751	4.63e-12	73.9	4861	0.028	0.008	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
19	Q8BNF7	5.03e-12	73.6	1203	0.028	0.032	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
20	Q9H0C5	6.15e-12	72.0	482	0.035	0.102	BTBD1_HUMAN BTB/POZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BTBD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08005 PHR	5.5e-39	145.7	PHR domain
2	PF00415 RCC1	3e-20	83.8	Regulator of chromosome condensation (RCC1) repeat
3	PF13540 RCC1_2	1.2e-20	84.0	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013609

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004877	0.976	F-box protein 45
2	60711.ENSCSAP00000011574	0.943	Ribonucleic acid export 1
3	60711.ENSCSAP00000007404	0.824	splA/ryanodine receptor domain and SOCS box containing 4
4	60711.ENSCSAP00000017239	0.824	splA/ryanodine receptor domain and SOCS box containing 1
5	60711.ENSCSAP00000001793	0.746	May be an activator of the JNK/SAPK pathway.
6	60711.ENSCSAP00000010130	0.746	Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7
7	60711.ENSCSAP00000012017	0.736	Low density lipoprotein receptor-related protein associated protein 1
8	60711.ENSCSAP00000009793	0.720	Belongs to the SKP1 family.
9	60711.ENSCSAP00000017232	0.699	Nicotinamide nucleotide adenylyltransferase 1
10	60711.ENSCSAP00000006343	0.652	MYC proto-oncogene, bHLH transcription factor
11	60711.ENSCSAP00000012405	0.613	Lysine (K)-specific demethylase 3A
12	60711.ENSCSAP00000014280	0.604	RCC1 like
13	60711.ENSCSAP00000001645	0.589	annotation not available
14	60711.ENSCSAP00000018444	0.589	annotation not available
15	60711.ENSCSAP00000008262	0.587	IQ motif and Sec7 domain 3
16	60711.ENSCSAP00000016796	0.585	Nuclear autoantigenic sperm protein (histone-binding)
17	60711.ENSCSAP00000007379	0.583	Nicotinamide nucleotide adenylyltransferase 3
18	60711.ENSCSAP00000008815	0.580	Nicotinamide nucleotide adenylyltransferase 2
19	60711.ENSCSAP00000002000	0.559	Chromosome 11 open reading frame 49
20	60711.ENSCSAP00000008807	0.559	Transmembrane protein 236

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019787	0.998	ubiquitin-like protein transferase activity
GO:0004842	0.993	ubiquitin-protein transferase activity
GO:0030695	0.889	GTPase regulator activity
GO:0005085	0.874	guanyl-nucleotide exchange factor activity
GO:0042802	0.636	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.966	regulation of biological process
GO:0019222	0.890	regulation of metabolic process
GO:0031398	0.869	positive regulation of protein ubiquitination
GO:0009987	0.866	cellular process
GO:0048511	0.858	rhythmic process
GO:0016567	0.841	protein ubiquitination
GO:0007623	0.795	circadian rhythm
GO:0050794	0.747	regulation of cellular process
GO:0032922	0.657	circadian regulation of gene expression
GO:0050896	0.541	response to stimulus
GO:0032501	0.434	multicellular organismal process
GO:0032502	0.410	developmental process
GO:0048856	0.403	anatomical structure development
GO:0071840	0.386	cellular component organization or biogenesis
GO:0048731	0.384	system development
GO:0022008	0.366	neurogenesis
GO:0031323	0.354	regulation of cellular metabolic process
GO:0016043	0.327	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005737	0.997	cytoplasm
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005634	0.979	nucleus
GO:0005829	0.884	cytosol
GO:0031974	0.880	membrane-enclosed lumen
GO:0031981	0.869	nuclear lumen
GO:0005654	0.798	nucleoplasm
GO:0016020	0.510	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]