StarFunc result for job id O75593

User Input

>input (365 residues)
MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQII
RQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEAL
RLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGA
PWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGP
STLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSC
PQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLL
SWCSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75593	1.000	1.000	4.517E-61	365	1.000	1.000	O75593.pdb.gz	FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens OX=9606 GN=FOXH1 PE=1 SV=1
2	AFDB:P70056	0.331	0.240	3.457E-19	518	0.416	0.293	P70056.pdb.gz	FOXH1_XENLA Forkhead box protein H1 OS=Xenopus laevis OX=8355 GN=foxh1 PE=1 SV=3
3	AFDB:Q9I9E1	0.340	0.268	5.326E-19	472	0.364	0.282	Q9I9E1.pdb.gz	FOXH1_DANRE Forkhead box protein H1 OS=Danio rerio OX=7955 GN=foxh1 PE=1 SV=1
4	AFDB:Q12946	0.246	0.238	1.028E-10	379	0.252	0.243	Q12946.pdb.gz	FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens OX=9606 GN=FOXF1 PE=1 SV=2
5	AFDB:Q9PTK2	0.215	0.215	1.400E-10	365	0.233	0.233	Q9PTK2.pdb.gz	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1
6	AFDB:O60548	0.224	0.167	1.906E-10	495	0.266	0.196	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
7	AFDB:P55316	0.241	0.182	5.118E-10	489	0.230	0.172	P55316.pdb.gz	FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens OX=9606 GN=FOXG1 PE=1 SV=2
8	AFDB:Q16676	0.226	0.180	5.791E-10	465	0.238	0.187	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
9	AFDB:P79772	0.225	0.209	1.292E-9	394	0.200	0.185	P79772.pdb.gz	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
10	AFDB:A0A2R8QK25	0.220	0.210	2.711E-9	383	0.203	0.193	A0A2R8QK25.pdb.gz
11	PDB:2hdcA	0.177	0.546	1.082E-5	97	0.099	0.371	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7a6hO	0.132	0.100	1.370E-1	512	0.044	0.031	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
13	PDB:6zmiCE	0.150	0.652	1.984E-1	72	0.022	0.111	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:2nyxB	0.151	0.334	2.245E-1	147	0.036	0.088	2nyxB.pdb.gz
15	PDB:6qpqD	0.153	0.520	2.245E-1	82	0.027	0.122	6qpqD.pdb.gz
16	PDB:4etsB	0.155	0.334	2.540E-1	149	0.019	0.047	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
17	PDB:7dn3O	0.143	0.120	2.540E-1	443	0.033	0.027	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
18	PDB:1xsdA	0.157	0.386	3.056E-1	125	0.030	0.088	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
19	PDB:5fj9O	0.133	0.096	3.251E-1	528	0.033	0.023	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
20	PDB:5v8fE	0.158	0.139	3.251E-1	422	0.041	0.036	5v8fE.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75593	0.0	724	365	1.000	1.000	FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens OX=9606 GN=FOXH1 PE=1 SV=1
2	O88621	0.0	522	401	0.775	0.706	FOXH1_MOUSE Forkhead box protein H1 OS=Mus musculus OX=10090 GN=Foxh1 PE=1 SV=1
3	P70056	1.83e-54	189	518	0.241	0.170	FOXH1_XENLA Forkhead box protein H1 OS=Xenopus laevis OX=8355 GN=foxh1 PE=1 SV=3
4	Q8JIT7	4.80e-51	175	344	0.219	0.233	FAST3_XENLA Forkhead activin signal transducer 3 OS=Xenopus laevis OX=8355 GN=fast3 PE=1 SV=1
5	Q9I9E1	1.11e-46	167	472	0.384	0.297	FOXH1_DANRE Forkhead box protein H1 OS=Danio rerio OX=7955 GN=foxh1 PE=1 SV=1
6	E7FER3	5.48e-25	107	429	0.129	0.110	E7FER3_DANRE Forkhead box F2b OS=Danio rerio OX=7955 GN=foxf2b PE=4 SV=1
7	Q61080	9.21e-25	105	378	0.132	0.127	FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus OX=10090 GN=Foxf1 PE=2 SV=2
8	Q9W707	1.16e-24	105	372	0.132	0.129	FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1
9	Q12946	3.50e-24	104	379	0.126	0.121	FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens OX=9606 GN=FOXF1 PE=1 SV=2
10	A1L1S5	3.80e-24	104	380	0.112	0.108	FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio OX=7955 GN=foxf1 PE=2 SV=1
11	B0UXI3	6.40e-24	103	422	0.126	0.109	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
12	Q12947	7.05e-24	104	444	0.121	0.099	FOXF2_HUMAN Forkhead box protein F2 OS=Homo sapiens OX=9606 GN=FOXF2 PE=1 SV=2
13	O54743	7.82e-24	103	446	0.123	0.101	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
14	Q63248	9.73e-24	96.3	101	0.118	0.426	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
15	Q9PTK2	1.42e-23	102	365	0.137	0.137	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1
16	Q9QY14	3.50e-23	99.8	288	0.142	0.181	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
17	A0A0R4IJS9	4.74e-23	100	312	0.126	0.147	A0A0R4IJS9_DANRE Forkhead box Q1a OS=Danio rerio OX=7955 GN=foxq1l PE=4 SV=1
18	O70220	8.42e-23	100	400	0.118	0.107	FOXQ1_MOUSE Forkhead box protein Q1 OS=Mus musculus OX=10090 GN=Foxq1 PE=2 SV=3
19	Q07342	1.49e-22	100	409	0.134	0.120	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
20	Q9C009	2.02e-22	99.8	403	0.118	0.107	FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens OX=9606 GN=FOXQ1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	6.3e-23	92.1	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366534

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.999	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000341551	0.999	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000332973	0.990	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000327758	0.985	Homeobox protein Nkx-2.5
5	9606.ENSP00000307850	0.973	Dr1-associated corepressor
6	9606.ENSP00000263253	0.926	Histone acetyltransferase p300
7	9606.ENSP00000476046	0.902	mRNA-decapping enzyme 1A
8	9606.ENSP00000296145	0.816	Teratocarcinoma-derived growth factor 1
9	9606.ENSP00000442439	0.744	Homeobox protein MIXL1
10	9606.ENSP00000259216	0.730	Cryptic protein
11	9606.ENSP00000304169	0.725	Pituitary homeobox 2
12	9606.ENSP00000355785	0.710	Left-right determination factor 2
13	9606.ENSP00000272134	0.679	Left-right determination factor 1
14	9606.ENSP00000261654	0.661	Adhesion G-protein coupled receptor D1
15	9606.ENSP00000287139	0.656	Nodal homolog
16	9606.ENSP00000340361	0.633	Activin receptor type-2B
17	9606.ENSP00000259915	0.632	POU domain, class 5, transcription factor 1
18	9606.ENSP00000442656	0.617	Activin receptor type-1B
19	9606.ENSP00000238558	0.591	Homeobox protein goosecoid
20	9606.ENSP00000340874	0.582	Myocyte-specific enhancer factor 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000987	0.981	cis-regulatory region sequence-specific DNA binding
GO:0008134	0.975	transcription factor binding
GO:0140297	0.959	DNA-binding transcription factor binding
GO:0046332	0.944	SMAD binding
GO:0070412	0.928	R-SMAD binding
GO:0061629	0.913	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.846	nuclear receptor binding
GO:0019904	0.833	protein domain specific binding
GO:0050681	0.815	nuclear androgen receptor binding
GO:0043425	0.809	bHLH transcription factor binding
GO:0000981	0.745	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0070410	0.555	co-SMAD binding
GO:0000977	0.549	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:1903506	0.993	regulation of nucleic acid-templated transcription
GO:0009987	0.992	cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0032502	0.975	developmental process
GO:0009893	0.967	positive regulation of metabolic process
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0048856	0.947	anatomical structure development
GO:0071363	0.939	cellular response to growth factor stimulus
GO:0007167	0.930	enzyme-linked receptor protein signaling pathway
GO:0048523	0.929	negative regulation of cellular process
GO:0032501	0.928	multicellular organismal process
GO:0048522	0.927	positive regulation of cellular process
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:0051173	0.908	positive regulation of nitrogen compound metabolic process
GO:0007178	0.902	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045944	0.896	positive regulation of transcription by RNA polymerase II
GO:0007275	0.892	multicellular organism development
GO:0071560	0.796	cellular response to transforming growth factor beta stimulus
GO:0007179	0.753	transforming growth factor beta receptor signaling pathway
GO:0009966	0.687	regulation of signal transduction
GO:0048731	0.611	system development
GO:0009892	0.541	negative regulation of metabolic process
GO:0048513	0.505	animal organ development
GO:0010605	0.498	negative regulation of macromolecule metabolic process
GO:0042221	0.489	response to chemical
GO:0051172	0.475	negative regulation of nitrogen compound metabolic process
GO:0031324	0.458	negative regulation of cellular metabolic process
GO:0045892	0.446	negative regulation of DNA-templated transcription
GO:0009653	0.381	anatomical structure morphogenesis
GO:0065009	0.318	regulation of molecular function
GO:0000122	0.316	negative regulation of transcription by RNA polymerase II
GO:0010033	0.306	response to organic substance
GO:0070887	0.302	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0090575	0.989	RNA polymerase II transcription regulator complex
GO:0070013	0.976	intracellular organelle lumen
GO:0005654	0.965	nucleoplasm
GO:0005694	0.734	chromosome
GO:0000785	0.697	chromatin
GO:0032444	0.384	activin responsive factor complex
GO:0005737	0.317	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]