StarFunc result for job id O75594

User Input

>input (196 residues)
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVS
HTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGH
LWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPG
NQLYHLIQNWPHYRSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75594	1.000	1.000	3.589E-45	196	1.000	1.000	O75594.pdb.gz	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
2	PDB:1yckA	0.850	0.997	9.946E-38	167	0.852	1.000	1yckA.pdb.gz
3	AFDB:Q9GK12	0.842	0.855	1.705E-33	193	0.709	0.720	Q9GK12.pdb.gz	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
4	AFDB:O88593	0.832	0.895	2.352E-32	182	0.643	0.692	O88593.pdb.gz	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
5	AFDB:Q9JLN4	0.840	0.899	1.242E-31	183	0.622	0.667	Q9JLN4.pdb.gz	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
6	PDB:3cg9A	0.855	0.978	3.621E-31	171	0.658	0.754	3cg9A.pdb.gz	Crystal structure of the complex of peptidoglycan recognition protein with methyoxane-2,3,4,5-tetrol at 2.9 A resolution
7	AFDB:Q0VB07	0.831	0.439	1.343E-24	374	0.393	0.206	Q0VB07.pdb.gz	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
8	AFDB:A1A547	0.828	0.472	1.627E-24	347	0.388	0.219	A1A547.pdb.gz	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
9	AFDB:Q9VXN9	0.830	0.478	4.532E-24	345	0.362	0.206	Q9VXN9.pdb.gz	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
10	AFDB:Q9V4X2	0.836	0.890	6.241E-24	184	0.423	0.451	Q9V4X2.pdb.gz	PGSC2_DROME Peptidoglycan-recognition protein SC2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SC2 PE=2 SV=1
11	AFDB:Q96LB9	0.824	0.476	6.654E-24	341	0.388	0.223	Q96LB9.pdb.gz	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
12	AFDB:Q96LB8	0.829	0.439	9.164E-24	373	0.372	0.196	Q96LB8.pdb.gz	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
13	PDB:1sxrA	0.823	0.930	6.990E-22	173	0.362	0.410	1sxrA.pdb.gz
14	PDB:2rkqA	0.807	0.934	7.944E-22	169	0.362	0.420	2rkqA.pdb.gz
15	PDB:1ohtA	0.821	0.928	7.975E-20	173	0.301	0.341	1ohtA.pdb.gz	Crystal Structure of Peptidoglycan Recognition Protein Lb from Drosophila Melanogaster
16	PDB:6fhgA	0.593	0.732	2.564E-11	156	0.209	0.263	6fhgA.pdb.gz	Structure and function of the Ts2631 endolysin of Thermus scotoductus phage vB_Tsc2631 with unique N-terminal extension used for peptidoglycan binding.
17	PDB:1aroL	0.520	0.670	4.883E-9	149	0.189	0.248	1aroL.pdb.gz
18	PDB:4bj4A	0.457	0.372	8.230E-4	246	0.173	0.138	4bj4A.pdb.gz
19	PDB:1j3gA	0.437	0.452	4.078E-3	187	0.143	0.150	1j3gA.pdb.gz	NMR Structure of Citrobacter freundii AmpD, Comparison with Bacteriophage T7 Lysozyme and Homology with PGRP Domains
20	PDB:3d2yA	0.408	0.320	1.667E-2	257	0.143	0.109	3d2yA.pdb.gz	Specific Structural Features of the N-Acetylmuramoyl-l-Alanine Amidase AmiD from Escherichia coli and Mechanistic Implications for Enzymes of This Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75594	2.30e-147	409	196	1.000	1.000	PGRP1_HUMAN Peptidoglycan recognition protein 1 OS=Homo sapiens OX=9606 GN=PGLYRP1 PE=1 SV=1
2	Q9GK12	4.16e-96	279	193	0.658	0.668	PGRP1_CAMDR Peptidoglycan recognition protein 1 OS=Camelus dromedarius OX=9838 GN=PGLYRP1 PE=1 SV=1
3	O88593	1.04e-89	262	182	0.607	0.654	PGRP1_MOUSE Peptidoglycan recognition protein 1 OS=Mus musculus OX=10090 GN=Pglyrp1 PE=1 SV=1
4	Q9JLN4	1.20e-87	257	183	0.628	0.672	PGRP1_RAT Peptidoglycan recognition protein 1 OS=Rattus norvegicus OX=10116 GN=Pglyrp1 PE=1 SV=1
5	A1A547	2.58e-54	178	347	0.398	0.225	PGRP3_MOUSE Peptidoglycan recognition protein 3 OS=Mus musculus OX=10090 GN=Pglyrp3 PE=2 SV=2
6	Q96LB9	1.11e-51	171	341	0.393	0.226	PGRP3_HUMAN Peptidoglycan recognition protein 3 OS=Homo sapiens OX=9606 GN=PGLYRP3 PE=1 SV=1
7	Q9V4X2	2.52e-51	165	184	0.393	0.418	PGSC2_DROME Peptidoglycan-recognition protein SC2 OS=Drosophila melanogaster OX=7227 GN=PGRP-SC2 PE=2 SV=1
8	Q0VB07	1.47e-49	166	374	0.388	0.203	PGRP4_MOUSE Peptidoglycan recognition protein 4 OS=Mus musculus OX=10090 GN=Pglyrp4 PE=2 SV=1
9	Q96LB8	4.99e-48	162	373	0.378	0.198	PGRP4_HUMAN Peptidoglycan recognition protein 4 OS=Homo sapiens OX=9606 GN=PGLYRP4 PE=1 SV=2
10	C0HK98	1.47e-47	155	185	0.403	0.427	SC1A_DROME Peptidoglycan-recognition protein SC1a OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1a PE=3 SV=1
11	C0HK99	1.47e-47	155	185	0.403	0.427	SC1B_DROME Peptidoglycan-recognition protein SC1b OS=Drosophila melanogaster OX=7227 GN=PGRP-SC1b PE=1 SV=1
12	Q9VYX7	5.84e-45	149	203	0.372	0.360	PGPSA_DROME Peptidoglycan-recognition protein SA OS=Drosophila melanogaster OX=7227 GN=PGRP-SA PE=1 SV=1
13	Q9VXN9	8.04e-39	137	345	0.367	0.209	PGPLE_DROME Peptidoglycan-recognition protein LE OS=Drosophila melanogaster OX=7227 GN=PGRP-LE PE=1 SV=1
14	Q9VS97	2.42e-38	132	186	0.357	0.376	PGPSD_DROME Peptidoglycan-recognition protein SD OS=Drosophila melanogaster OX=7227 GN=PGRP-SD PE=1 SV=1
15	Q70PY2	8.00e-38	131	190	0.311	0.321	PGSB1_DROME Peptidoglycan-recognition protein SB1 OS=Drosophila melanogaster OX=7227 GN=PGRP-SB1 PE=2 SV=2
16	Q8INK6	1.97e-35	126	232	0.332	0.280	PGPLB_DROME Peptidoglycan-recognition protein LB OS=Drosophila melanogaster OX=7227 GN=PGRP-LB PE=1 SV=1
17	Q8SXQ7	2.05e-35	129	369	0.311	0.165	PGPLF_DROME Peptidoglycan-recognition protein LF OS=Drosophila melanogaster OX=7227 GN=PGRP-LF PE=1 SV=1
18	Q96PD5	2.09e-35	132	576	0.357	0.122	PGRP2_HUMAN N-acetylmuramoyl-L-alanine amidase OS=Homo sapiens OX=9606 GN=PGLYRP2 PE=1 SV=1
19	A0A060VTM4	4.66e-35	130	491	0.352	0.141	A0A060VTM4_ONCMY Peptidoglycan recognition protein 6 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077461001 PE=3 SV=1
20	B7ZUU1	4.78e-35	130	497	0.342	0.135	B7ZUU1_DANRE Pglyrp6 protein OS=Danio rerio OX=7955 GN=pglyrp6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01510 Amidase_2	1.9e-17	75.3	N-acetylmuramoyl-L-alanine amidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000008938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.988	Heat shock protein family A member 4
2	9606.ENSP00000244709	0.976	Triggering receptor expressed on myeloid cells 1
3	9606.ENSP00000357705	0.846	S100 calcium binding protein A4
4	9606.ENSP00000162749	0.817	Tumor necrosis factor receptor superfamily member 1A
5	9606.ENSP00000215567	0.718	Very-long-chain enoyl-CoA reductase
6	9606.ENSP00000296435	0.696	Cathelicidin antimicrobial peptide
7	9606.ENSP00000297435	0.675	Neutrophil defensin 4
8	9606.ENSP00000361467	0.649	Disks large homolog 5
9	9606.ENSP00000262865	0.644	Bactericidal permeability-increasing protein
10	9606.ENSP00000430684	0.640	Inhibitor of nuclear factor kappa-B kinase subunit beta
11	9606.ENSP00000383303	0.598	Down syndrome cell adhesion molecule
12	9606.ENSP00000255631	0.595	Hsp70-binding protein 1
13	9606.ENSP00000291842	0.591	SH3KBP1-binding protein 1
14	9606.ENSP00000255040	0.582	Serum amyloid P-component
15	9606.ENSP00000357726	0.564	Protein S100-A12
16	9606.ENSP00000222823	0.556	Nucleotide-binding oligomerization domain-containing protein 1
17	9606.ENSP00000372139	0.547	Neutrophil defensin 1
18	9606.ENSP00000300589	0.544	Nucleotide-binding oligomerization domain-containing protein 2
19	9606.ENSP00000372136	0.543	Defensin, alpha 1B
20	9606.ENSP00000231751	0.524	Lactotransferrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038187	0.999	pattern recognition receptor activity
GO:0042834	0.999	peptidoglycan binding
GO:0005515	0.990	protein binding
GO:0003824	0.961	catalytic activity
GO:0016019	0.861	peptidoglycan immune receptor activity
GO:0016787	0.766	hydrolase activity
GO:0008745	0.651	N-acetylmuramoyl-L-alanine amidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.971	cellular process
GO:0009605	0.959	response to external stimulus
GO:0044419	0.956	biological process involved in interspecies interaction between organisms
GO:0051707	0.954	response to other organism
GO:0006952	0.948	defense response
GO:0042742	0.940	defense response to bacterium
GO:0006959	0.929	humoral immune response
GO:0050789	0.897	regulation of biological process
GO:0050830	0.866	defense response to Gram-positive bacterium
GO:0019730	0.850	antimicrobial humoral response
GO:0051606	0.778	detection of stimulus
GO:0050794	0.776	regulation of cellular process
GO:0001906	0.749	cell killing
GO:0009595	0.724	detection of biotic stimulus
GO:0061844	0.702	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0008152	0.508	metabolic process
GO:0098581	0.487	detection of external biotic stimulus
GO:0019222	0.481	regulation of metabolic process
GO:0031640	0.457	killing of cells of another organism
GO:0048583	0.440	regulation of response to stimulus
GO:0071704	0.429	organic substance metabolic process
GO:0060255	0.400	regulation of macromolecule metabolic process
GO:0048518	0.395	positive regulation of biological process
GO:0010468	0.375	regulation of gene expression
GO:0051239	0.365	regulation of multicellular organismal process
GO:0048519	0.342	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.998	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0031982	0.994	vesicle
GO:0070013	0.988	intracellular organelle lumen
GO:0031410	0.966	cytoplasmic vesicle
GO:0042581	0.959	specific granule
GO:0071944	0.956	cell periphery
GO:0034774	0.956	secretory granule lumen
GO:0043230	0.946	extracellular organelle
GO:0065010	0.913	extracellular membrane-bounded organelle
GO:1903561	0.901	extracellular vesicle
GO:0070062	0.892	extracellular exosome
GO:0035580	0.889	specific granule lumen
GO:0016020	0.877	membrane
GO:0070820	0.765	tertiary granule
GO:1904724	0.744	tertiary granule lumen
GO:0071682	0.731	endocytic vesicle lumen
GO:0045335	0.432	phagocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.766	Hydrolases.
EC:3.5.1.28	0.651	N-acetylmuramoyl-L-alanine amidase.

[back to server]