StarFunc result for job id O75600

User Input

>input (419 residues)
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLSSVRFICGTQSIHKNLEAKIA
RFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLD
MADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLG
PTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP
AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICPVMLGDARLAS
RMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75600	1.000	1.000	2.542E-86	419	1.000	1.000	O75600.pdb.gz	KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens OX=9606 GN=GCAT PE=1 SV=1
2	AFDB:Q57YK7	0.919	0.953	7.883E-60	404	0.530	0.550	Q57YK7.pdb.gz	Q57YK7_TRYB2 2-amino-3-ketobutyrate coenzyme A ligase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.760 PE=3 SV=1
3	AFDB:P0AB77	0.931	0.979	2.115E-58	398	0.511	0.538	P0AB77.pdb.gz	KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) OX=83333 GN=kbl PE=1 SV=1
4	PDB:1fc4A	0.937	0.979	1.155E-55	401	0.511	0.534	1fc4A.pdb.gz	Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism.
5	AFDB:Q5SHZ8	0.907	0.962	7.393E-46	395	0.394	0.418	Q5SHZ8.pdb.gz	BIKB_THET8 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1582 PE=1 SV=1
6	PDB:7poaA	0.906	0.953	7.408E-46	398	0.394	0.415	7poaA.pdb.gz	An Irreversible, Promiscuous and Highly Thermostable Claisen-Condensation Biocatalyst Drives the Synthesis of Substituted Pyrroles
7	AFDB:A7LXM2	0.896	0.952	5.723E-44	394	0.291	0.310	A7LXM2.pdb.gz	SPT_BACO1 Serine palmitoyltransferase OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=spt PE=3 SV=1
8	AFDB:P9WQ85	0.871	0.478	1.022E-41	771	0.274	0.149	P9WQ85.pdb.gz	BIOF2_MYCTU Putative 8-amino-7-oxononanoate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bioF2 PE=1 SV=1
9	AFDB:A2R9H8	0.902	0.588	8.046E-41	649	0.325	0.210	A2R9H8.pdb.gz	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
10	AFDB:Q5W264	0.879	0.571	1.756E-40	653	0.303	0.194	Q5W264.pdb.gz	PIGH_SERS3 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigH PE=1 SV=1
11	AFDB:O14092	0.896	0.677	8.848E-40	558	0.310	0.233	O14092.pdb.gz	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
12	AFDB:Q7T2F0	0.890	0.614	6.229E-39	613	0.291	0.199	Q7T2F0.pdb.gz	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1
13	PDB:5txrA	0.890	0.781	6.138E-38	479	0.308	0.269	5txrA.pdb.gz	Structure of the Mitochondrial Aminolevulinic Acid Synthase, a Key Heme Biosynthetic Enzyme.
14	PDB:1dj9A	0.846	0.923	2.474E-37	383	0.274	0.300	1dj9A.pdb.gz	Mechanism of 8-amino-7-oxononanoate synthase: spectroscopic, kinetic, and crystallographic studies.
15	PDB:7cqiT	0.847	0.715	1.206E-34	498	0.315	0.265	7cqiT.pdb.gz	Structural insights into the assembly and substrate selectivity of human SPT-ORMDL3 complex.
16	PDB:7k0mA	0.830	0.751	1.992E-34	464	0.270	0.244	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
17	PDB:3ntjB	0.672	0.712	6.163E-18	393	0.136	0.145	3ntjB.pdb.gz
18	PDB:4wydA	0.655	0.640	8.145E-18	430	0.162	0.158	4wydA.pdb.gz	Fragment-Based Exploration of Binding Site Flexibility in Mycobacterium tuberculosis BioA.
19	PDB:4adeB	0.649	0.765	3.105E-17	350	0.150	0.180	4adeB.pdb.gz
20	PDB:5x6bJ	0.625	0.686	7.577E-17	377	0.117	0.130	5x6bJ.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75600	0.0	860	419	1.000	1.000	KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens OX=9606 GN=GCAT PE=1 SV=1
2	O88986	0.0	776	416	0.907	0.913	KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus OX=10090 GN=Gcat PE=1 SV=2
3	Q57YK7	4.33e-152	438	404	0.518	0.537	Q57YK7_TRYB2 2-amino-3-ketobutyrate coenzyme A ligase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.760 PE=3 SV=1
4	P0AB77	6.76e-149	430	398	0.516	0.543	KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) OX=83333 GN=kbl PE=1 SV=1
5	Q5SHZ8	2.53e-94	290	395	0.384	0.408	BIKB_THET8 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1582 PE=1 SV=1
6	A7LXM2	4.52e-68	223	394	0.291	0.310	SPT_BACO1 Serine palmitoyltransferase OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=spt PE=3 SV=1
7	P08680	1.60e-67	226	587	0.322	0.230	HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas2 PE=1 SV=3
8	P22557	8.73e-67	224	587	0.308	0.220	HEM0_HUMAN 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS2 PE=1 SV=2
9	A2R9H8	9.85e-67	226	649	0.337	0.217	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
10	Q63147	1.27e-66	224	587	0.320	0.228	HEM0_RAT 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas2 PE=1 SV=1
11	Q5W264	1.08e-64	221	653	0.308	0.198	PIGH_SERS3 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigH PE=1 SV=1
12	O14092	2.07e-64	218	558	0.286	0.215	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
13	Q8A9E5	1.31e-63	211	394	0.289	0.307	SPT_BACTN Serine palmitoyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=spt PE=1 SV=1
14	Q9YHT4	3.59e-62	212	583	0.298	0.214	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
15	O94069	6.40e-62	211	564	0.310	0.230	HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEM1 PE=3 SV=2
16	P09950	2.05e-60	207	548	0.301	0.230	HEM1_YEAST 5-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM1 PE=1 SV=1
17	Q8I4X1	4.27e-59	205	630	0.260	0.173	Q8I4X1_PLAF7 5-aminolevulinate synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246100 PE=3 SV=1
18	P13195	2.49e-58	203	642	0.289	0.188	HEM1_RAT 5-aminolevulinate synthase, non-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2
19	O18680	3.94e-58	201	539	0.289	0.224	O18680_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
20	Q7T2F0	4.25e-58	202	613	0.298	0.204	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	2.3e-63	226.2	Aminotransferase class I and II
2	PF00266 Aminotran_5	0.5	20.9	Aminotransferase class-V
3	PF01212 Beta_elim_lyase	69	14.2	Beta-eliminating lyase
4	PF01053 Cys_Met_Meta_PP	22	15.1	Cys/Met metabolism PLP-dependent enzyme
5	PF01041 DegT_DnrJ_EryC1	5.2e+02	11.2	DegT/DnrJ/EryC1/StrS aminotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000049680

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000002013	0.807	Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L- serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate
2	9598.ENSPTRP00000027445	0.781	Quinoid dihydropteridine reductase
3	9598.ENSPTRP00000049477	0.755	Glycine cleavage system P protein
4	9598.ENSPTRP00000024714	0.695	Uncharacterized protein
5	9598.ENSPTRP00000035898	0.694	Belongs to the protein kinase superfamily.
6	9598.ENSPTRP00000004870	0.673	Delta-1-pyrroline-5-carboxylate synthase
7	9598.ENSPTRP00000035973	0.667	Transducin-like enhancer of split 4
8	9598.ENSPTRP00000010343	0.660	Probable tRNA N6-adenosine threonylcarbamoyltransferase
9	9598.ENSPTRP00000025761	0.658	Aminomethyltransferase
10	9598.ENSPTRP00000034212	0.644	Methionine sulfoxide reductase A
11	9598.ENSPTRP00000006860	0.643	Galanin prepropeptide
12	9598.ENSPTRP00000018006	0.633	glutaryl-CoA dehydrogenase
13	9598.ENSPTRP00000027418	0.630	Uncharacterized protein
14	9598.ENSPTRP00000016435	0.618	Uncharacterized protein
15	9598.ENSPTRP00000035327	0.604	Tissue specific transplantation antigen P35B
16	9598.ENSPTRP00000008712	0.576	Serine hydroxymethyltransferase
17	9598.ENSPTRP00000014673	0.565	MYB binding protein (P160) 1a
18	9598.ENSPTRP00000014317	0.558	Glycine cleavage system H protein
19	9598.ENSPTRP00000010626	0.557	Signal recognition particle 54 kDa protein
20	9598.ENSPTRP00000027584	0.551	ATPase, class V, type 10D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016408	0.999	C-acyltransferase activity
GO:0005515	0.998	protein binding
GO:0043167	0.920	ion binding
GO:1901363	0.897	heterocyclic compound binding
GO:0097159	0.897	organic cyclic compound binding
GO:0036094	0.667	small molecule binding
GO:0019842	0.599	vitamin binding
GO:0070279	0.566	vitamin B6 binding
GO:0030170	0.561	pyridoxal phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0009058	0.941	biosynthetic process
GO:0034641	0.892	cellular nitrogen compound metabolic process
GO:1901576	0.872	organic substance biosynthetic process
GO:0044249	0.844	cellular biosynthetic process
GO:1901566	0.812	organonitrogen compound biosynthetic process
GO:0044271	0.799	cellular nitrogen compound biosynthetic process
GO:0044238	0.794	primary metabolic process
GO:0046483	0.738	heterocycle metabolic process
GO:1901360	0.680	organic cyclic compound metabolic process
GO:0044281	0.655	small molecule metabolic process
GO:0019752	0.336	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005654	0.989	nucleoplasm
GO:0016020	0.977	membrane
GO:0005829	0.844	cytosol
GO:0031090	0.835	organelle membrane
GO:0031967	0.693	organelle envelope
GO:0031966	0.665	mitochondrial membrane
GO:0019866	0.661	organelle inner membrane
GO:0005743	0.642	mitochondrial inner membrane
GO:0016604	0.361	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]