StarFunc result for job id O75603

User Input

>input (506 residues)
MPAAAVQEAVGVCSYGMQLSWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRH
LSGWAMRNTNNHNGHILKKSCLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACPN
CHSALELIPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMA
SFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPEDFDIVTETSFPIPGQPCPSFPKSDV
YKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANPGYTNSSPYPTLYKDSTSIPN
DTDWVHLNTLQCNVNSYSSYERSFDFTNKQHGWKPALGKPSLVERTNHGQFQAMATRPYY
NPELPCRYLTTPPPGAPALQTVITTTTKVSYQAYQPPAMKYSDSVREVKSLSSCNYAPED
TGMSVYPEPWGPPVTVTRAASPSGPPPMKIAGDCRAIRPTVAIPHEPVSSRTDEAETWDV
CLSGLGSAVSYSDRVGPFFTYNNEDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75603	0.999	0.999	6.583E-79	506	1.000	1.000	O75603.pdb.gz	GCM2_HUMAN Chorion-specific transcription factor GCMb OS=Homo sapiens OX=9606 GN=GCM2 PE=1 SV=1
2	AFDB:O09102	0.523	0.525	2.509E-57	504	0.688	0.690	O09102.pdb.gz	GCM2_MOUSE Chorion-specific transcription factor GCMb OS=Mus musculus OX=10090 GN=Gcm2 PE=2 SV=2
3	AFDB:Q2KT54	0.397	0.405	1.637E-42	496	0.480	0.490	Q2KT54.pdb.gz
4	AFDB:P70348	0.330	0.381	7.956E-29	436	0.310	0.360	P70348.pdb.gz	GCM1_MOUSE Chorion-specific transcription factor GCMa OS=Mus musculus OX=10090 GN=Gcm1 PE=1 SV=1
5	AFDB:Q9Z288	0.334	0.386	1.615E-28	436	0.302	0.351	Q9Z288.pdb.gz	GCM1_RAT Chorion-specific transcription factor GCMa OS=Rattus norvegicus OX=10116 GN=Gcm1 PE=2 SV=1
6	AFDB:Q9NP62	0.328	0.378	1.818E-28	436	0.292	0.339	Q9NP62.pdb.gz	GCM1_HUMAN Chorion-specific transcription factor GCMa OS=Homo sapiens OX=9606 GN=GCM1 PE=1 SV=1
7	AFDB:Q9VLA2	0.315	0.265	9.470E-26	606	0.310	0.259	Q9VLA2.pdb.gz	GCM2_DROME Transcription factor glial cells missing 2 OS=Drosophila melanogaster OX=7227 GN=gcm2 PE=2 SV=4
8	AFDB:B3DGX3	0.086	0.081	2.118E-2	543	0.144	0.134	B3DGX3.pdb.gz
9	AFDB:R9PY33	0.090	0.072	2.383E-2	651	0.123	0.095	R9PY33.pdb.gz	R9PY33_DROME Runt related A, isoform C OS=Drosophila melanogaster OX=7227 GN=RunxA PE=4 SV=1
10	AFDB:F6NGQ6	0.090	0.080	5.444E-2	589	0.146	0.126	F6NGQ6.pdb.gz	F6NGQ6_DANRE DAB adaptor protein 2 OS=Danio rerio OX=7955 GN=sb:cb778 PE=1 SV=1
11	PDB:2flhB	0.085	0.187	2.212E-1	153	0.043	0.144	2flhB.pdb.gz	Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.
12	PDB:4igvA	0.089	0.217	2.212E-1	149	0.024	0.081	4igvA.pdb.gz
13	PDB:3jcuP	0.071	0.160	2.800E-1	172	0.026	0.076	3jcuP.pdb.gz	Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
14	PDB:3saoA	0.049	0.113	2.971E-1	150	0.030	0.100	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
15	PDB:7myjC	0.076	0.081	2.971E-1	465	0.040	0.043	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:2r55A	0.065	0.139	3.151E-1	208	0.051	0.125	2r55A.pdb.gz
17	PDB:5n47A	0.051	0.096	3.151E-1	180	0.032	0.089	5n47A.pdb.gz
18	PDB:2kt4B	0.061	0.130	3.343E-1	157	0.038	0.121	2kt4B.pdb.gz	The v-myc-induced Q83 lipocalin is a siderocalin.
19	PDB:2mphA	0.062	0.105	3.762E-1	224	0.045	0.103	2mphA.pdb.gz
20	PDB:6b1uA	0.079	0.086	3.990E-1	442	0.032	0.036	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09102	0.0	714	504	0.688	0.690	GCM2_MOUSE Chorion-specific transcription factor GCMb OS=Mus musculus OX=10090 GN=Gcm2 PE=2 SV=2
2	O75603	0.0	1057	506	1.000	1.000	GCM2_HUMAN Chorion-specific transcription factor GCMb OS=Homo sapiens OX=9606 GN=GCM2 PE=1 SV=1
3	Q68BU9	7.55e-155	452	496	0.496	0.506	Q68BU9_DANRE Chorion-specific transcription factor GCMb OS=Danio rerio OX=7955 GN=GCMb PE=2 SV=1
4	Q5TLZ9	3.60e-151	442	478	0.488	0.517	Q5TLZ9_DANRE Chorion-specific transcription factor GCMb isoform X1 OS=Danio rerio OX=7955 GN=Gcm-2 PE=2 SV=1
5	P70348	1.64e-76	249	436	0.219	0.255	GCM1_MOUSE Chorion-specific transcription factor GCMa OS=Mus musculus OX=10090 GN=Gcm1 PE=1 SV=1
6	Q9Z288	2.09e-76	248	436	0.219	0.255	GCM1_RAT Chorion-specific transcription factor GCMa OS=Rattus norvegicus OX=10116 GN=Gcm1 PE=2 SV=1
7	Q9NP62	2.33e-72	238	436	0.211	0.245	GCM1_HUMAN Chorion-specific transcription factor GCMa OS=Homo sapiens OX=9606 GN=GCM1 PE=1 SV=1
8	Q27403	5.10e-66	223	504	0.194	0.194	GCM_DROME Transcription factor glial cells missing OS=Drosophila melanogaster OX=7227 GN=gcm PE=1 SV=2
9	Q9VLA2	1.15e-64	222	606	0.202	0.168	GCM2_DROME Transcription factor glial cells missing 2 OS=Drosophila melanogaster OX=7227 GN=gcm2 PE=2 SV=4
10	Q90410	0.63	35.0	418	0.057	0.069	Q90410_DANRE GATA binding protein 1a OS=Danio rerio OX=7955 GN=zg1 PE=2 SV=1
11	Q9ZPI5	0.99	34.7	725	0.034	0.023	MFP2_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana OX=3702 GN=MFP2 PE=1 SV=1
12	P23767	2.6	33.1	359	0.047	0.067	GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis OX=8355 GN=gata1-a PE=2 SV=1
13	Q9VUN3	3.8	32.0	217	0.043	0.101	RANL_DROME GTP-binding nuclear protein Ran-like OS=Drosophila melanogaster OX=7227 GN=Ran-like PE=1 SV=1
14	A0A8I5ZXI2	4.5	32.0	243	0.051	0.107	A0A8I5ZXI2_RAT Rho GDP dissociation inhibitor beta OS=Rattus norvegicus OX=10116 GN=Arhgdib PE=1 SV=1
15	Q9TU03	6.6	31.2	200	0.053	0.135	GDIR2_BOVIN Rho GDP-dissociation inhibitor 2 OS=Bos taurus OX=9913 GN=ARHGDIB PE=2 SV=3
16	Q61410	7.0	32.0	762	0.028	0.018	KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus OX=10090 GN=Prkg2 PE=1 SV=1
17	P53958	7.2	31.6	396	0.036	0.045	BOP3_YEAST Protein BOP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOP3 PE=1 SV=1
18	Q64595	7.5	32.0	762	0.028	0.018	KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Prkg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03615 GCM	2.9e-69	242.9	GCM motif protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259803	0.835	Chorion-specific transcription factor GCMa
2	9606.ENSP00000420194	0.782	Extracellular calcium-sensing receptor
3	9606.ENSP00000226247	0.739	Forkhead box protein N1
4	9606.ENSP00000283141	0.738	Synaptonemal complex protein 2-like
5	9606.ENSP00000282091	0.729	Parathyroid hormone
6	9606.ENSP00000321999	0.716	Parathyroid hormone/parathyroid hormone-related peptide receptor
7	9606.ENSP00000292476	0.678	Cleavage and polyadenylation specificity factor subunit 4
8	9606.ENSP00000265310	0.618	Transient receptor potential cation channel subfamily V member 5
9	9606.ENSP00000263270	0.617	AP-2 complex subunit sigma
10	9606.ENSP00000356405	0.611	Parafibromin
11	9606.ENSP00000264938	0.585	Sodium/hydrogen exchanger 3
12	9606.ENSP00000352358	0.584	Transient receptor potential cation channel subfamily V member 6
13	9606.ENSP00000078429	0.562	Guanine nucleotide-binding protein subunit alpha-11
14	9606.ENSP00000272847	0.553	Parathyroid hormone 2 receptor
15	9606.ENSP00000439170	0.549	Tubulin-specific chaperone E
16	9606.ENSP00000331791	0.535	T-box transcription factor TBX1
17	9606.ENSP00000304286	0.529	Forkhead box protein I1
18	9606.ENSP00000337088	0.522	Menin
19	9606.ENSP00000291582	0.518	Autoimmune regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.987	developmental process
GO:0009987	0.986	cellular process
GO:0048856	0.981	anatomical structure development
GO:0032501	0.977	multicellular organismal process
GO:0007275	0.951	multicellular organism development
GO:0048731	0.927	system development
GO:0048513	0.926	animal organ development
GO:0071704	0.829	organic substance metabolic process
GO:0065007	0.768	biological regulation
GO:0050789	0.761	regulation of biological process
GO:0050794	0.715	regulation of cellular process
GO:0055074	0.712	calcium ion homeostasis
GO:0044238	0.687	primary metabolic process
GO:0044237	0.647	cellular metabolic process
GO:0043170	0.579	macromolecule metabolic process
GO:0006807	0.526	nitrogen compound metabolic process
GO:0019222	0.458	regulation of metabolic process
GO:0031323	0.453	regulation of cellular metabolic process
GO:0080090	0.452	regulation of primary metabolic process
GO:0051171	0.452	regulation of nitrogen compound metabolic process
GO:0019219	0.438	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.433	regulation of macromolecule metabolic process
GO:0010468	0.417	regulation of gene expression
GO:0031326	0.416	regulation of cellular biosynthetic process
GO:0006355	0.411	regulation of DNA-templated transcription
GO:0050896	0.315	response to stimulus
GO:0048869	0.301	cellular developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]