StarFunc result for job id O75607

User Input

>input (178 residues)
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75607	1.000	1.000	3.078E-31	178	1.000	1.000	O75607.pdb.gz	NPM3_HUMAN Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3
2	AFDB:Q9CPP0	0.706	0.718	6.904E-26	175	0.770	0.783	Q9CPP0.pdb.gz	NPM3_MOUSE Nucleoplasmin-3 OS=Mus musculus OX=10090 GN=Npm3 PE=1 SV=3
3	AFDB:P05221	0.576	0.515	1.831E-15	200	0.360	0.320	P05221.pdb.gz	NUPL_XENLA Nucleoplasmin OS=Xenopus laevis OX=8355 PE=1 SV=1
4	AFDB:P07222	0.667	0.415	2.266E-15	299	0.326	0.194	P07222.pdb.gz	NPM_XENLA Nucleophosmin OS=Xenopus laevis OX=8355 GN=npm1 PE=1 SV=1
5	AFDB:F1RD77	0.619	0.341	1.184E-14	329	0.320	0.173	F1RD77.pdb.gz
6	AFDB:Q7T362	0.583	0.373	1.914E-14	282	0.315	0.199	Q7T362.pdb.gz
7	AFDB:A0A0S2Z491	0.613	0.376	2.635E-14	294	0.309	0.187	A0A0S2Z491.pdb.gz	A0A0S2Z491_HUMAN Nucleophosmin (Fragment) OS=Homo sapiens OX=9606 GN=NPM1 PE=2 SV=1
8	AFDB:Q80W85	0.552	0.483	5.866E-14	207	0.298	0.256	Q80W85.pdb.gz	NPM2_MOUSE Nucleoplasmin-2 OS=Mus musculus OX=10090 GN=Npm2 PE=2 SV=1
9	AFDB:A0A2R8QS89	0.606	0.564	8.987E-14	193	0.315	0.290	A0A2R8QS89.pdb.gz
10	AFDB:Q7M6Z1	0.545	0.478	1.798E-13	207	0.326	0.280	Q7M6Z1.pdb.gz
11	PDB:7sqyB	0.293	0.297	3.361E-3	175	0.118	0.120	7sqyB.pdb.gz
12	PDB:1js9C	0.296	0.284	6.375E-3	189	0.129	0.122	1js9C.pdb.gz
13	PDB:3i26D	0.288	0.165	1.497E-2	369	0.096	0.046	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
14	PDB:7z8bC	0.286	0.062	1.665E-2	1224	0.112	0.016	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
15	PDB:5fl1A	0.240	0.085	1.756E-2	703	0.090	0.023	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.
16	PDB:4kncB	0.147	0.077	2.419E-2	419	0.051	0.021	4kncB.pdb.gz
17	PDB:4lejA	0.198	0.130	2.551E-2	355	0.079	0.039	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
18	PDB:7rslA	0.294	0.243	2.691E-2	235	0.107	0.081	7rslA.pdb.gz
19	PDB:3v0aB	0.262	0.066	2.994E-2	1150	0.084	0.013	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
20	PDB:3wg3A	0.260	0.276	2.994E-2	163	0.062	0.067	3wg3A.pdb.gz	Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75607	8.34e-130	363	178	1.000	1.000	NPM3_HUMAN Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3
2	Q9CPP0	6.02e-95	275	175	0.803	0.817	NPM3_MOUSE Nucleoplasmin-3 OS=Mus musculus OX=10090 GN=Npm3 PE=1 SV=3
3	P07222	1.06e-28	109	299	0.309	0.184	NPM_XENLA Nucleophosmin OS=Xenopus laevis OX=8355 GN=npm1 PE=1 SV=1
4	P05221	6.55e-28	105	200	0.309	0.275	NUPL_XENLA Nucleoplasmin OS=Xenopus laevis OX=8355 PE=1 SV=1
5	Q6GQG6	3.42e-27	103	200	0.303	0.270	Q6GQG6_XENLA Npm-A protein OS=Xenopus laevis OX=8355 GN=npm2.L PE=1 SV=1
6	A0A140VJQ2	2.53e-25	100	259	0.275	0.189	A0A140VJQ2_HUMAN Testicular tissue protein Li 128 OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q5BL09	2.85e-25	99.8	257	0.275	0.191	Q5BL09_MOUSE Npm1 protein OS=Mus musculus OX=10090 GN=Npm1 PE=2 SV=1
8	A0A0S2Z491	6.70e-25	99.8	294	0.275	0.167	A0A0S2Z491_HUMAN Nucleophosmin (Fragment) OS=Homo sapiens OX=9606 GN=NPM1 PE=2 SV=1
9	P06748	6.70e-25	99.8	294	0.275	0.167	NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2
10	P13084	7.99e-25	99.4	292	0.275	0.168	NPM_RAT Nucleophosmin OS=Rattus norvegicus OX=10116 GN=Npm1 PE=1 SV=1
11	Q61937	7.99e-25	99.4	292	0.275	0.168	NPM_MOUSE Nucleophosmin OS=Mus musculus OX=10090 GN=Npm1 PE=1 SV=1
12	E7FCU0	2.39e-22	92.8	279	0.264	0.168	E7FCU0_DANRE Nucleophosmin OS=Danio rerio OX=7955 GN=npm1 PE=1 SV=1
13	B2CQD3	1.29e-20	85.9	182	0.242	0.236	B2CQD3_DANRE Nucleophosmin/nucleoplasmin, 2b OS=Danio rerio OX=7955 GN=npm2 PE=1 SV=2
14	Q566X7	7.82e-19	83.6	307	0.230	0.134	Q566X7_DANRE Nucleophosmin (Fragment) OS=Danio rerio OX=7955 GN=npm4 PE=2 SV=1
15	A0A8I5YBJ6	3.56e-17	77.4	210	0.225	0.190	A0A8I5YBJ6_RAT Nucleophosmin/nucleoplasmin 2 OS=Rattus norvegicus OX=10116 GN=Npm2 PE=3 SV=1
16	Q80W85	5.99e-17	77.0	207	0.219	0.188	NPM2_MOUSE Nucleoplasmin-2 OS=Mus musculus OX=10090 GN=Npm2 PE=2 SV=1
17	Q86SE8	1.79e-16	75.9	214	0.275	0.229	NPM2_HUMAN Nucleoplasmin-2 OS=Homo sapiens OX=9606 GN=NPM2 PE=1 SV=1
18	Q9NLA3	4.26e-12	65.5	346	0.315	0.162	ANO39_PATPE Nucleoplasmin-like protein ANO39 OS=Patiria pectinifera OX=7594 PE=1 SV=1
19	E5RI98	2.10e-10	59.7	230	0.146	0.113	E5RI98_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2
20	Q27415	2.76e-07	50.1	152	0.197	0.230	NLP_DROME Nucleoplasmin-like protein OS=Drosophila melanogaster OX=7227 GN=Nlp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02087 Nitrophorin	27	16.2	Nitrophorin
2	PF17800 NPL	9.5e+02	11.8	Nucleoplasmin-like domain
3	PF03066 Nucleoplasmin	6e-32	121.6	Nucleoplasmin/nucleophosmin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381032	0.986	Nucleoplasmin-2
2	9606.ENSP00000296930	0.899	Nucleophosmin
3	9606.ENSP00000238256	0.861	FK506-binding protein 15
4	9606.ENSP00000296417	0.787	Histone H2A.Z
5	9606.ENSP00000308405	0.778	Histone H2A.V
6	9606.ENSP00000318195	0.775	Nucleolin
7	9606.ENSP00000410059	0.674	Elongation factor 1-delta
8	9606.ENSP00000370376	0.670	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
9	9606.ENSP00000338862	0.655	Ribosome biogenesis protein BRX1 homolog
10	9606.ENSP00000483667	0.645	Chromodomain-helicase-DNA-binding protein 1
11	9606.ENSP00000321797	0.640	Fibroblast growth factor 8
12	9606.ENSP00000322469	0.630	Uncharacterized protein C3orf38
13	9606.ENSP00000264010	0.629	Transcriptional repressor CTCF
14	9606.ENSP00000354850	0.623	Protein O-GlcNAcase
15	9606.ENSP00000415579	0.605	Transcriptional repressor CTCFL
16	9606.ENSP00000262302	0.604	Cytosolic Fe-S cluster assembly factor NUBP2
17	9606.ENSP00000478303	0.585	DNA-directed RNA polymerases I, II, and III subunit RPABC1
18	9606.ENSP00000255120	0.573	Nuclear autoantigenic sperm protein
19	9606.ENSP00000325738	0.527	Nuclear transition protein 2
20	9606.ENSP00000405965	0.520	Small ubiquitin-related modifier 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.998	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044238	0.956	primary metabolic process
GO:0071704	0.942	organic substance metabolic process
GO:0071840	0.939	cellular component organization or biogenesis
GO:0006807	0.921	nitrogen compound metabolic process
GO:0044237	0.885	cellular metabolic process
GO:0044085	0.852	cellular component biogenesis
GO:0043170	0.841	macromolecule metabolic process
GO:1901360	0.793	organic cyclic compound metabolic process
GO:0034641	0.792	cellular nitrogen compound metabolic process
GO:0006725	0.786	cellular aromatic compound metabolic process
GO:0090304	0.781	nucleic acid metabolic process
GO:0050789	0.750	regulation of biological process
GO:0050794	0.743	regulation of cellular process
GO:0016070	0.696	RNA metabolic process
GO:0010467	0.686	gene expression
GO:0044249	0.686	cellular biosynthetic process
GO:1901576	0.681	organic substance biosynthetic process
GO:0016072	0.628	rRNA metabolic process
GO:0034654	0.617	nucleobase-containing compound biosynthetic process
GO:0098781	0.567	ncRNA transcription
GO:0009303	0.442	rRNA transcription
GO:0006396	0.436	RNA processing
GO:0034470	0.397	ncRNA processing
GO:0048518	0.379	positive regulation of biological process
GO:0019222	0.345	regulation of metabolic process
GO:0016043	0.341	cellular component organization
GO:0022613	0.327	ribonucleoprotein complex biogenesis
GO:0048522	0.326	positive regulation of cellular process
GO:0080090	0.315	regulation of primary metabolic process
GO:0051171	0.312	regulation of nitrogen compound metabolic process
GO:0031323	0.312	regulation of cellular metabolic process
GO:0060255	0.310	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005829	0.979	cytosol
GO:0005654	0.969	nucleoplasm
GO:0005856	0.628	cytoskeleton
GO:0032991	0.392	protein-containing complex
GO:0015629	0.303	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]