StarFunc result for job id O75610

User Input

>input (366 residues)
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQ
YVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00292	0.956	0.956	2.095E-64	366	0.956	0.956	O00292.pdb.gz	LFTY2_HUMAN Left-right determination factor 2 OS=Homo sapiens OX=9606 GN=LEFTY2 PE=1 SV=2
2	AFDB:P57785	0.935	0.930	1.844E-60	368	0.825	0.821	P57785.pdb.gz	LFTY2_MOUSE Left-right determination factor 2 OS=Mus musculus OX=10090 GN=Lefty2 PE=2 SV=2
3	AFDB:Q64280	0.915	0.910	6.580E-58	368	0.820	0.815	Q64280.pdb.gz	LFTY1_MOUSE Left-right determination factor 1 OS=Mus musculus OX=10090 GN=Lefty1 PE=2 SV=1
4	AFDB:A0A0B5JW28	0.778	0.785	1.812E-36	362	0.358	0.362	A0A0B5JW28.pdb.gz
5	AFDB:Q9PVN4	0.466	0.471	7.629E-35	362	0.366	0.370	Q9PVN4.pdb.gz	Q9PVN4_CHICK Left-right determination factor OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:Q9PW55	0.718	0.732	9.447E-35	358	0.363	0.372	Q9PW55.pdb.gz	Q9PW55_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=xx:tdsubc_2b12 PE=1 SV=1
7	AFDB:C8C060	0.348	0.324	1.124E-16	396	0.224	0.207	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
8	AFDB:Q9VQG9	0.328	0.211	1.724E-16	586	0.210	0.131	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
9	AFDB:P58166	0.316	0.328	4.756E-16	350	0.172	0.180	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
10	AFDB:Q90752	0.323	0.294	6.554E-16	405	0.219	0.198	Q90752.pdb.gz	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
11	PDB:5ntuA	0.300	0.348	1.946E-14	308	0.194	0.231	5ntuA.pdb.gz
12	PDB:5hlyA	0.327	0.393	5.371E-14	299	0.142	0.174	5hlyA.pdb.gz
13	PDB:5vqfB	0.303	0.340	9.618E-13	320	0.191	0.219	5vqfB.pdb.gz
14	PDB:5nxsA	0.277	0.339	1.641E-12	290	0.169	0.214	5nxsA.pdb.gz
15	PDB:5ffoG	0.288	0.341	3.116E-12	297	0.199	0.246	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
16	PDB:7y1rB	0.258	0.300	2.021E-11	308	0.197	0.234	7y1rB.pdb.gz
17	PDB:3rjrC	0.293	0.309	2.249E-11	343	0.189	0.201	3rjrC.pdb.gz
18	PDB:6umxA	0.285	0.359	2.503E-11	279	0.167	0.219	6umxA.pdb.gz
19	PDB:5nxsB	0.290	0.409	2.110E-9	251	0.150	0.219	5nxsB.pdb.gz
20	PDB:6ds5A	0.195	0.376	6.283E-3	160	0.044	0.100	6ds5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00292	0.0	709	366	0.956	0.956	LFTY2_HUMAN Left-right determination factor 2 OS=Homo sapiens OX=9606 GN=LEFTY2 PE=1 SV=2
2	O75610	0.0	742	366	1.000	1.000	LFTY1_HUMAN Left-right determination factor 1 OS=Homo sapiens OX=9606 GN=LEFTY1 PE=2 SV=1
3	P57785	0.0	602	368	0.825	0.821	LFTY2_MOUSE Left-right determination factor 2 OS=Mus musculus OX=10090 GN=Lefty2 PE=2 SV=2
4	Q64280	0.0	591	368	0.817	0.812	LFTY1_MOUSE Left-right determination factor 1 OS=Mus musculus OX=10090 GN=Lefty1 PE=2 SV=1
5	Q9PVN4	9.52e-82	255	362	0.385	0.390	Q9PVN4_CHICK Left-right determination factor OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q9PW55	5.52e-80	251	358	0.355	0.363	Q9PW55_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=xx:tdsubc_2b12 PE=1 SV=1
7	Q9W6I7	3.19e-76	241	362	0.363	0.367	Q9W6I7_DANRE Left-right determination factor OS=Danio rerio OX=7955 GN=cb720 PE=2 SV=1
8	Q9PUK3	2.83e-73	232	320	0.342	0.391	Q9PUK3_CHICK LEFTY-1 protein (Fragment) OS=Gallus gallus OX=9031 GN=LEFTY-1 PE=2 SV=1
9	Q90752	3.12e-12	69.7	405	0.172	0.156	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
10	A5HMF9	3.40e-12	69.3	404	0.169	0.153	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
11	O57574	4.34e-11	66.2	400	0.137	0.125	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
12	A5HMF8	8.06e-11	65.1	404	0.167	0.151	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
13	P21275	1.64e-10	64.3	408	0.164	0.147	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
14	Q4AEG6	3.04e-10	63.5	421	0.156	0.135	BMP10_RAT Bone morphogenetic protein 10 OS=Rattus norvegicus OX=10116 GN=Bmp10 PE=2 SV=1
15	E9QHW0	3.10e-10	63.2	379	0.199	0.193	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
16	Q06826	3.33e-10	63.5	408	0.164	0.147	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
17	Q8UVQ2	4.27e-10	63.2	391	0.175	0.164	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
18	P12644	3.55e-09	60.1	408	0.161	0.145	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
19	Q04999	1.29e-08	58.5	411	0.191	0.170	INHBB_MOUSE Inhibin beta B chain OS=Mus musculus OX=10090 GN=Inhbb PE=2 SV=4
20	Q9PTF9	1.29e-08	58.5	432	0.167	0.141	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	2.4e-07	42.2	TGF-beta propeptide
2	PF00019 TGF_beta	2.5e-06	39.7	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287139	0.955	Nodal homolog
2	9606.ENSP00000296145	0.921	Teratocarcinoma-derived growth factor 1
3	9606.ENSP00000340361	0.902	Activin receptor type-2B
4	9606.ENSP00000355785	0.872	Left-right determination factor 2
5	9606.ENSP00000259216	0.869	Cryptic protein
6	9606.ENSP00000304169	0.848	Pituitary homeobox 2
7	9606.ENSP00000442656	0.848	Activin receptor type-1B
8	9606.ENSP00000238682	0.821	Transforming growth factor beta-3
9	9606.ENSP00000221930	0.812	Transforming growth factor beta-1
10	9606.ENSP00000259915	0.782	POU domain, class 5, transcription factor 1
11	9606.ENSP00000243349	0.760	Activin receptor type-1C
12	9606.ENSP00000241416	0.720	Activin receptor type-2A
13	9606.ENSP00000370297	0.717	Cerberus
14	9606.ENSP00000229307	0.716	Homeobox protein NANOG
15	9606.ENSP00000366534	0.679	Forkhead box protein H1
16	9606.ENSP00000287538	0.676	Zinc finger protein ZIC 3
17	9606.ENSP00000262160	0.674	Mothers against decapentaplegic homolog 2
18	9606.ENSP00000323588	0.662	Transcription factor SOX-2
19	9606.ENSP00000204604	0.641	Chordin
20	9606.ENSP00000331745	0.641	Growth/differentiation factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.949	signaling receptor binding
GO:0098772	0.756	molecular function regulator activity
GO:0030545	0.595	signaling receptor regulator activity
GO:0048018	0.543	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.978	anatomical structure development
GO:0050896	0.977	response to stimulus
GO:0007275	0.962	multicellular organism development
GO:0071363	0.928	cellular response to growth factor stimulus
GO:0007178	0.909	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071559	0.899	response to transforming growth factor beta
GO:0048513	0.888	animal organ development
GO:0048731	0.859	system development
GO:0019222	0.847	regulation of metabolic process
GO:0060255	0.835	regulation of macromolecule metabolic process
GO:0080090	0.799	regulation of primary metabolic process
GO:0051171	0.799	regulation of nitrogen compound metabolic process
GO:0048519	0.794	negative regulation of biological process
GO:0031323	0.773	regulation of cellular metabolic process
GO:0010468	0.769	regulation of gene expression
GO:0009889	0.767	regulation of biosynthetic process
GO:0048518	0.760	positive regulation of biological process
GO:0019219	0.733	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.727	negative regulation of cellular process
GO:0010556	0.718	regulation of macromolecule biosynthetic process
GO:0048522	0.707	positive regulation of cellular process
GO:0031326	0.705	regulation of cellular biosynthetic process
GO:0051252	0.683	regulation of RNA metabolic process
GO:1903506	0.669	regulation of nucleic acid-templated transcription
GO:0006355	0.658	regulation of DNA-templated transcription
GO:0048583	0.559	regulation of response to stimulus
GO:0010646	0.550	regulation of cell communication
GO:0009653	0.515	anatomical structure morphogenesis
GO:0023051	0.499	regulation of signaling
GO:0090092	0.494	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006357	0.391	regulation of transcription by RNA polymerase II
GO:0042127	0.380	regulation of cell population proliferation
GO:0071560	0.356	cellular response to transforming growth factor beta stimulus
GO:0009888	0.339	tissue development
GO:0050793	0.333	regulation of developmental process
GO:0007179	0.330	transforming growth factor beta receptor signaling pathway
GO:0030154	0.322	cell differentiation
GO:0009790	0.322	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0070013	0.975	intracellular organelle lumen
GO:0043231	0.854	intracellular membrane-bounded organelle
GO:0005737	0.654	cytoplasm
GO:0071944	0.535	cell periphery
GO:0012505	0.533	endomembrane system
GO:0005634	0.408	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]