StarFunc result for job id O75616

User Input

>input (437 residues)
MAAPSWRGARLVQSVLRVWQVGPHVARERVIPFSSLLGFQRRCVSCVAGSAFSGPRLASA
SRSNGQGSALDHFLGFSQPDSSVTPCVPAVSMNRDEQDVLLVHHPDMPENSRVLRVVLLG
APNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRH
HLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDC
LKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWP
HFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHL
PQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM
DIFLCDVDIRLSVKLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75616	1.000	1.000	8.929E-91	437	1.000	1.000	O75616.pdb.gz	ERAL1_HUMAN GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2
2	AFDB:Q09523	0.668	0.739	1.101E-31	394	0.215	0.239	Q09523.pdb.gz	ERAL1_CAEEL GTPase Era, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=eral-1 PE=3 SV=1
3	AFDB:Q8VZ74	0.542	0.554	8.876E-28	427	0.240	0.246	Q8VZ74.pdb.gz	ERA_ARATH GTPase ERA-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g66470 PE=2 SV=1
4	AFDB:O82653	0.576	0.576	1.063E-27	437	0.249	0.249	O82653.pdb.gz	ERG_ARATH GTP-binding protein ERG OS=Arabidopsis thaliana OX=3702 GN=ERG PE=1 SV=2
5	AFDB:K7UTH7	0.554	0.580	6.048E-27	416	0.243	0.255	K7UTH7.pdb.gz	ERA1_MAIZE GTPase ERA1, chloroplastic OS=Zea mays OX=4577 GN=ERA1 PE=2 SV=1
6	AFDB:P42182	0.582	0.830	2.402E-26	301	0.181	0.262	P42182.pdb.gz	ERA_BACSU GTPase Era OS=Bacillus subtilis (strain 168) OX=224308 GN=era PE=1 SV=1
7	AFDB:P06616	0.590	0.843	6.658E-26	301	0.199	0.289	P06616.pdb.gz	ERA_ECOLI GTPase Era OS=Escherichia coli (strain K12) OX=83333 GN=era PE=1 SV=2
8	AFDB:P37214	0.576	0.827	6.658E-26	299	0.176	0.258	P37214.pdb.gz	ERA_STRMU GTPase Era OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=era PE=1 SV=2
9	AFDB:Q5SM23	0.571	0.812	1.076E-25	301	0.217	0.316	Q5SM23.pdb.gz	ERA_THET8 GTPase Era OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=era PE=1 SV=1
10	AFDB:Q387K3	0.568	0.644	4.816E-25	382	0.156	0.178	Q387K3.pdb.gz	Q387K3_TRYB2 G domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0660 PE=3 SV=1
11	PDB:1wf3A	0.571	0.825	9.065E-24	296	0.213	0.314	1wf3A.pdb.gz	Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
12	PDB:3ieuA	0.345	0.493	5.287E-19	293	0.195	0.290	3ieuA.pdb.gz	Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
13	PDB:7o9kG	0.324	0.413	8.864E-8	337	0.103	0.134	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
14	PDB:4zi2A	0.289	0.636	1.061E-7	185	0.085	0.200	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
15	PDB:1uptG	0.310	0.737	1.820E-7	170	0.092	0.235	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
16	PDB:5ady6	0.250	0.256	2.179E-7	426	0.087	0.089	5ady6.pdb.gz	Hflx is a Ribosome Splitting Factor Rescuing Stalled Ribosomes Under Stress Conditions
17	PDB:2ew1A	0.311	0.742	2.314E-7	171	0.080	0.205	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
18	PDB:3doeA	0.301	0.640	2.314E-7	189	0.085	0.196	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
19	PDB:3j8gX	0.285	0.296	2.314E-7	418	0.135	0.141	3j8gX.pdb.gz	Structural insights into the function of a unique tandem GTPase EngA in bacterial ribosome assembly
20	PDB:4mitC	0.278	0.621	2.314E-7	181	0.076	0.182	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75616	0.0	893	437	1.000	1.000	ERAL1_HUMAN GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2
2	O82653	2.48e-42	156	437	0.240	0.240	ERG_ARATH GTP-binding protein ERG OS=Arabidopsis thaliana OX=3702 GN=ERG PE=1 SV=2
3	Q09523	3.12e-32	128	394	0.220	0.244	ERAL1_CAEEL GTPase Era, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=eral-1 PE=3 SV=1
4	K7UTH7	1.86e-28	118	416	0.215	0.226	ERA1_MAIZE GTPase ERA1, chloroplastic OS=Zea mays OX=4577 GN=ERA1 PE=2 SV=1
5	Q8VZ74	9.28e-27	113	427	0.213	0.218	ERA_ARATH GTPase ERA-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g66470 PE=2 SV=1
6	P06616	2.79e-23	101	301	0.195	0.282	ERA_ECOLI GTPase Era OS=Escherichia coli (strain K12) OX=83333 GN=era PE=1 SV=2
7	Q5SM23	5.94e-23	100	301	0.215	0.312	ERA_THET8 GTPase Era OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=era PE=1 SV=1
8	P42182	1.44e-21	96.7	301	0.176	0.256	ERA_BACSU GTPase Era OS=Bacillus subtilis (strain 168) OX=224308 GN=era PE=1 SV=1
9	P37214	4.98e-20	92.0	299	0.178	0.261	ERA_STRMU GTPase Era OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=era PE=1 SV=2
10	Q387K3	1.55e-12	70.9	382	0.149	0.170	Q387K3_TRYB2 G domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0660 PE=3 SV=1
11	P9WNK9	2.99e-12	69.3	300	0.183	0.267	ERA_MYCTU GTPase Era OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=era PE=1 SV=1
12	P25522	4.47e-07	54.3	454	0.112	0.108	MNME_ECOLI tRNA modification GTPase MnmE OS=Escherichia coli (strain K12) OX=83333 GN=mnmE PE=1 SV=3
13	A0A090N7X0	6.29e-07	53.5	329	0.080	0.106	A0A090N7X0_HUMAN GTPase, IMAP family member 4, isoform CRA_b OS=Homo sapiens OX=9606 GN=HIMAP4 PE=3 SV=1
14	Q9NUV9	6.29e-07	53.5	329	0.080	0.106	GIMA4_HUMAN GTPase IMAP family member 4 OS=Homo sapiens OX=9606 GN=GIMAP4 PE=1 SV=1
15	G5E9W9	1.36e-06	52.4	343	0.069	0.087	G5E9W9_HUMAN GTPase, IMAP family member 4 OS=Homo sapiens OX=9606 GN=GIMAP4 PE=1 SV=1
16	P0A6P5	5.70e-06	50.8	490	0.085	0.076	DER_ECOLI GTPase Der OS=Escherichia coli (strain K12) OX=83333 GN=der PE=1 SV=1
17	Q8KAS1	2.22e-05	48.9	473	0.089	0.082	MNME_CHLTE tRNA modification GTPase MnmE OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=mnmE PE=1 SV=1
18	P32559	6.10e-05	47.8	526	0.076	0.063	MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS1 PE=1 SV=2
19	Q75N62	7.66e-05	47.4	688	0.062	0.039	GIMA8_MOUSE GTPase IMAP family member 8 OS=Mus musculus OX=10090 GN=Gimap8 PE=1 SV=1
20	Q9N3F8	1.37e-04	45.4	213	0.082	0.169	Q9N3F8_CAEEL Small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=ral-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13521 AAA_28	61	15.3	AAA domain
2	PF04548 AIG1	4.9e-06	37.6	AIG1 family
3	PF00025 Arf	0.96	20.4	ADP-ribosylation factor family
4	PF03029 ATP_bind_1	37	15.5	Conserved hypothetical ATP binding protein
5	PF02492 cobW	1.5	19.8	CobW/HypB/UreG, nucleotide-binding domain
6	PF00350 Dynamin_N	8.7e-06	37.4	Dynamin family
7	PF02421 FeoB_N	4.5e-05	34.5	Ferrous iron transport protein B
8	PF00503 G-alpha	17	16.0	G-protein alpha subunit
9	PF00009 GTP_EFTU	0.0014	29.7	Elongation factor Tu GTP binding domain
10	PF00013 KH_1	5.6	18.2	KH domain
11	PF07650 KH_2	15	16.8	KH domain
12	PF01926 MMR_HSR1	3.6e-17	73.9	50S ribosome-binding GTPase
13	PF10662 PduV-EutP	3.9	18.7	Ethanolamine utilisation - propanediol utilisation
14	PF00071 Ras	3.4	18.7	Ras family
15	PF08477 Roc	1.2e+02	14.4	Ras of Complex, Roc, domain of DAPkinase
16	PF03193 RsgA_GTPase	0.00066	31.1	RsgA GTPase
17	PF09439 SRPRB	3.3e+02	12.1	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254928

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357320	0.955	28S ribosomal protein S29, mitochondrial
2	9606.ENSP00000418008	0.934	Mitochondrial ribosomal protein S22
3	9606.ENSP00000254630	0.920	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
4	9606.ENSP00000258455	0.911	Mitochondrial ribosomal protein S9
5	9606.ENSP00000245539	0.907	Mitochondrial ribosomal protein S7
6	9606.ENSP00000369682	0.898	Mitochondrial ribosomal protein S26
7	9606.ENSP00000360850	0.894	Mitochondrial ribosomal protein S2
8	9606.ENSP00000362036	0.894	Mitochondrial ribosomal protein S16
9	9606.ENSP00000177742	0.893	28S ribosomal protein S34, mitochondrial
10	9606.ENSP00000426941	0.886	28S ribosomal protein S27, mitochondrial
11	9606.ENSP00000361923	0.858	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
12	9606.ENSP00000256441	0.853	Mitochondrial ribosomal protein S36
13	9606.ENSP00000272418	0.852	Belongs to the universal ribosomal protein uS5 family.
14	9606.ENSP00000263629	0.851	Translation initiation factor IF-2, mitochondrial
15	9606.ENSP00000424328	0.846	Mitochondrial ribosomal protein S30
16	9606.ENSP00000253686	0.845	Mitochondrial ribosomal protein S25
17	9606.ENSP00000342676	0.845	Aurora kinase A-interacting protein
18	9606.ENSP00000362208	0.842	Mitochondrial ribosomal protein S15
19	9606.ENSP00000317376	0.831	Mitochondrial ribosomal protein S11
20	9606.ENSP00000382250	0.830	Mitochondrial ribosomal protein S6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019843	0.999	rRNA binding
GO:0043024	0.998	ribosomal small subunit binding
GO:0003824	0.604	catalytic activity
GO:0017111	0.486	ribonucleoside triphosphate phosphatase activity
GO:0097367	0.483	carbohydrate derivative binding
GO:0003924	0.471	GTPase activity
GO:0032555	0.467	purine ribonucleotide binding
GO:0043167	0.459	ion binding
GO:0043168	0.446	anion binding
GO:0035639	0.442	purine ribonucleoside triphosphate binding
GO:0032561	0.407	guanyl ribonucleotide binding
GO:0005525	0.389	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0042255	0.963	ribosome assembly
GO:0071826	0.954	ribonucleoprotein complex subunit organization
GO:0042274	0.942	ribosomal small subunit biogenesis
GO:0065003	0.925	protein-containing complex assembly
GO:0022618	0.871	ribonucleoprotein complex assembly
GO:0000028	0.836	ribosomal small subunit assembly
GO:0008152	0.678	metabolic process
GO:0071704	0.638	organic substance metabolic process
GO:0044237	0.611	cellular metabolic process
GO:0006807	0.610	nitrogen compound metabolic process
GO:0044238	0.601	primary metabolic process
GO:0050789	0.476	regulation of biological process
GO:0050794	0.453	regulation of cellular process
GO:0043170	0.399	macromolecule metabolic process
GO:0034641	0.377	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005829	0.993	cytosol
GO:0005759	0.962	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.486	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.486	nucleoside-triphosphate phosphatase.
RHEA:19669	0.471	GTP + H2O = GDP + H(+) + phosphate

[back to server]