StarFunc result for job id O75626

User Input

>input (825 residues)
MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTY
IVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEI
YTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQPSTEKNELCP
KNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVVYP
IRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTV
SPVGPGSQEHRDSYAYLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGM
NCNGLSAVSSMNGINNFGLFPRLCPVYSNLLGGGSLPHPMLNPTSLPSSLPSDGARRLLQ
PEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHVVQPKATSAAMAA
PSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGE
RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQ
CKVCPAKFTQFVHLKLHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPL
EDLTRINEEIEKFDISDNADRLEDVEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNM
GNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096MJU6	0.289	0.278	0.000	857	0.872	0.839	A0A096MJU6.pdb.gz	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
2	AFDB:O75626	1.000	1.000	0.000	825	1.000	1.000	O75626.pdb.gz	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
3	AFDB:Q5MB23	0.222	0.236	6.427E-75	776	0.544	0.579	Q5MB23.pdb.gz
4	AFDB:Q8BGV5	0.164	0.234	8.139E-16	572	0.131	0.189	Q8BGV5.pdb.gz	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
5	AFDB:E9PZZ1	0.103	0.112	6.104E-14	754	0.165	0.180	E9PZZ1.pdb.gz	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
6	AFDB:Q921B4	0.169	0.169	1.317E-13	824	0.145	0.146	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
7	AFDB:Q923B3	0.173	0.173	3.198E-13	828	0.138	0.138	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:E9PEP7	0.102	0.110	2.260E-11	755	0.121	0.132	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
9	AFDB:Q5EXX3	0.153	0.108	9.346E-11	1203	0.150	0.103	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
10	AFDB:P47043	0.161	0.152	2.554E-10	880	0.170	0.159	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
11	PDB:1pegA	0.128	0.341	1.516E-4	266	0.044	0.135	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
12	PDB:5hynA	0.110	0.153	1.921E-4	581	0.030	0.043	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
13	PDB:5wg6A	0.111	0.170	3.471E-4	517	0.032	0.050	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	PDB:7ksoA	0.111	0.218	6.270E-4	395	0.030	0.063	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
15	PDB:7td5F	0.111	0.193	6.270E-4	447	0.038	0.069	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
16	PDB:7td5A	0.116	0.183	7.057E-4	497	0.039	0.064	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:2g46A	0.111	0.576	8.941E-4	119	0.030	0.210	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
18	PDB:5h6zA	0.114	0.658	1.202E-3	123	0.025	0.171	5h6zA.pdb.gz
19	PDB:6wkrC	0.111	0.147	5.272E-3	606	0.035	0.048	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
20	PDB:3qxyA	0.063	0.120	2.453E-2	420	0.008	0.017	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJU6	0.0	1459	857	0.870	0.838	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
2	D4A1S2	0.0	1483	824	0.884	0.885	D4A1S2_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
3	O75626	0.0	1715	825	1.000	1.000	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
4	Q60636	0.0	1447	856	0.875	0.843	PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1
5	Q68EH4	0.0	796	776	0.545	0.580	Q68EH4_DANRE PR domain zinc finger protein 1 OS=Danio rerio OX=7955 GN=Blimp-1 PE=2 SV=2
6	Q9VRN4	6.19e-71	256	1203	0.137	0.094	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
7	M9PBR0	7.72e-71	256	1216	0.137	0.093	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
8	Q93560	1.04e-62	228	817	0.127	0.129	BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=blmp-1 PE=1 SV=1
9	Q8IZ20	2.87e-60	215	524	0.142	0.223	ZN683_HUMAN Tissue-resident T-cell transcription regulator protein ZNF683 OS=Homo sapiens OX=9606 GN=ZNF683 PE=1 SV=3
10	I7HJS4	9.31e-58	206	458	0.115	0.207	ZN683_MOUSE Tissue-resident T-cell transcription regulator protein ZNF683 OS=Mus musculus OX=10090 GN=Znf683 PE=2 SV=1
11	P10073	1.52e-39	155	491	0.085	0.143	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
12	Q16600	1.21e-36	146	458	0.080	0.144	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3
13	Q9R164	9.09e-36	147	701	0.088	0.104	Q9R164_MOUSE Zinc finger protein 111 OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
14	Q99K53	9.53e-36	147	700	0.088	0.104	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
15	Q96NJ3	1.77e-35	145	590	0.088	0.124	ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens OX=9606 GN=ZNF285 PE=1 SV=3
16	Q9Z117	2.39e-35	145	652	0.079	0.100	Q9Z117_MOUSE KRAB-containing zinc-finger protein KRAZ1 OS=Mus musculus OX=10090 GN=Zfp53 PE=1 SV=1
17	G3V9G6	2.69e-35	145	740	0.088	0.099	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
18	Q62788	3.02e-35	145	744	0.088	0.098	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
19	A0A8I6G8Y2	3.05e-35	145	723	0.088	0.101	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
20	A0A1Y7VIS4	3.21e-35	142	464	0.082	0.147	A0A1Y7VIS4_MOUSE Pluripotency associated transcript 25 OS=Mus musculus OX=10090 GN=Platr25 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	2.1e-05	36.4	SET domain
2	PF00096 zf-C2H2	3.1e-13	60.5	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.00014	33.4	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	0.024	25.9	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	24	16.6	Zinc-finger double-stranded RNA-binding
6	PF16278 zf-C2HE	40	16.1	C2HE / C2H2 / C2HC zinc-binding finger
7	PF13465 zf-H2C2_2	6.5e-23	91.3	Zinc-finger double domain
8	PF12874 zf-met	43	15.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319169	0.992	Protein arginine N-methyltransferase 5
2	9606.ENSP00000364678	0.992	Histone-lysine N-methyltransferase EHMT2
3	9606.ENSP00000430432	0.954	Histone deacetylase 2
4	9606.ENSP00000269305	0.943	Cellular tumor antigen p53
5	9606.ENSP00000370343	0.920	Interferon regulatory factor 4
6	9606.ENSP00000383042	0.910	Lysine-specific histone demethylase 1A
7	9606.ENSP00000216037	0.779	X-box-binding protein 1
8	9606.ENSP00000350844	0.776	Paired box protein Pax-5
9	9606.ENSP00000177694	0.768	T-box transcription factor TBX21
10	9606.ENSP00000292174	0.764	C-X-C chemokine receptor type 5
11	9606.ENSP00000250863	0.732	Deleted in azoospermia-like
12	9606.ENSP00000264657	0.729	Signal transducer and activator of transcription 3
13	9606.ENSP00000257749	0.726	Transcription regulator protein BACH2
14	9606.ENSP00000388620	0.722	Eomesodermin homolog
15	9606.ENSP00000370542	0.717	Syndecan-1
16	9606.ENSP00000341992	0.714	Nanos homolog 3
17	9606.ENSP00000384823	0.701	F-box only protein 11
18	9606.ENSP00000201031	0.690	Transcription factor AP-2 gamma
19	9606.ENSP00000320147	0.686	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000229335	0.683	Single-stranded DNA cytosine deaminase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.993	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.947	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.361	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0048519	0.983	negative regulation of biological process
GO:0019219	0.979	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0010468	0.944	regulation of gene expression
GO:0031326	0.938	regulation of cellular biosynthetic process
GO:0048523	0.935	negative regulation of cellular process
GO:0010556	0.935	regulation of macromolecule biosynthetic process
GO:0051252	0.935	regulation of RNA metabolic process
GO:0006355	0.929	regulation of DNA-templated transcription
GO:0050896	0.907	response to stimulus
GO:0009892	0.896	negative regulation of metabolic process
GO:0010605	0.891	negative regulation of macromolecule metabolic process
GO:0009987	0.877	cellular process
GO:0051172	0.875	negative regulation of nitrogen compound metabolic process
GO:0045892	0.865	negative regulation of DNA-templated transcription
GO:0048518	0.848	positive regulation of biological process
GO:0006357	0.843	regulation of transcription by RNA polymerase II
GO:0048522	0.810	positive regulation of cellular process
GO:0000122	0.804	negative regulation of transcription by RNA polymerase II
GO:0032501	0.562	multicellular organismal process
GO:0048856	0.545	anatomical structure development
GO:0009893	0.460	positive regulation of metabolic process
GO:0010604	0.451	positive regulation of macromolecule metabolic process
GO:0051716	0.338	cellular response to stimulus
GO:0051239	0.321	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.997	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]