StarFunc result for job id O75635

User Input

>input (380 residues)
MASLAAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHV
NTASGYGNSSNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEK
LYDAKVERVDFTNHLEDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGK
WQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFNLSVIEDPSMKILELRYNGGINMYVL
LPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIF
DESKADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSNIVEKQLPQSTLFRADHP
FLFVIRKDDIILFSGKVSCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75635	1.000	1.000	4.657E-85	380	1.000	1.000	O75635.pdb.gz	SPB7_HUMAN Serpin B7 OS=Homo sapiens OX=9606 GN=SERPINB7 PE=1 SV=1
2	AFDB:G3V6B5	0.986	0.986	2.662E-68	380	0.739	0.739	G3V6B5.pdb.gz	G3V6B5_RAT Serpin family B member 7 OS=Rattus norvegicus OX=10116 GN=Serpinb7 PE=3 SV=1
3	AFDB:P48595	0.950	0.911	3.640E-46	397	0.363	0.348	P48595.pdb.gz	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
4	AFDB:Q96P63	0.948	0.891	1.520E-45	405	0.403	0.378	Q96P63.pdb.gz	SPB12_HUMAN Serpin B12 OS=Homo sapiens OX=9606 GN=SERPINB12 PE=1 SV=1
5	AFDB:Q9D7P9	0.941	0.849	1.929E-45	423	0.418	0.376	Q9D7P9.pdb.gz	SPB12_MOUSE Serpin B12 OS=Mus musculus OX=10090 GN=Serpinb12 PE=2 SV=1
6	AFDB:P50452	0.929	0.944	2.172E-45	374	0.368	0.374	P50452.pdb.gz	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
7	AFDB:A0A0A0MQW3	0.906	0.863	2.926E-45	400	0.395	0.375	A0A0A0MQW3.pdb.gz	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
8	AFDB:P29508	0.940	0.916	3.105E-45	390	0.408	0.397	P29508.pdb.gz	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
9	AFDB:A2RSF9	0.917	0.903	3.498E-45	386	0.366	0.360	A2RSF9.pdb.gz	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
10	AFDB:R9TNA6	0.943	0.892	3.498E-45	402	0.400	0.378	R9TNA6.pdb.gz	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
11	PDB:2zv6B	0.899	0.919	3.829E-43	371	0.397	0.407	2zv6B.pdb.gz
12	PDB:4ga7A	0.909	0.936	1.801E-42	369	0.382	0.393	4ga7A.pdb.gz
13	PDB:2ol2A	0.884	0.931	8.463E-39	360	0.279	0.294	2ol2A.pdb.gz
14	PDB:2h4rA	0.881	0.902	2.623E-38	371	0.313	0.321	2h4rA.pdb.gz
15	PDB:2arqA	0.851	0.896	1.390E-37	360	0.358	0.378	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
16	PDB:1xqgA	0.853	0.857	1.475E-37	378	0.318	0.320	1xqgA.pdb.gz
17	PDB:1yxaA	0.889	0.907	2.282E-36	372	0.295	0.301	1yxaA.pdb.gz
18	PDB:3f1sA	0.882	0.871	2.571E-36	385	0.295	0.291	3f1sA.pdb.gz
19	PDB:1hp7A	0.881	0.890	3.462E-36	376	0.276	0.279	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
20	PDB:4x30A	0.871	0.889	6.665E-36	372	0.279	0.285	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V6B5	0.0	606	380	0.739	0.739	G3V6B5_RAT Serpin family B member 7 OS=Rattus norvegicus OX=10116 GN=Serpinb7 PE=3 SV=1
2	O75635	0.0	792	380	1.000	1.000	SPB7_HUMAN Serpin B7 OS=Homo sapiens OX=9606 GN=SERPINB7 PE=1 SV=1
3	Q920J5	0.0	602	380	0.737	0.737	Q920J5_RAT Megsin OS=Rattus norvegicus OX=10116 GN=Serpinb7 PE=2 SV=1
4	Q9D7P9	4.55e-93	287	423	0.421	0.378	SPB12_MOUSE Serpin B12 OS=Mus musculus OX=10090 GN=Serpinb12 PE=2 SV=1
5	R9TNA6	7.55e-92	283	402	0.403	0.381	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
6	P01014	3.86e-91	281	388	0.403	0.394	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
7	Q9UIV8	1.43e-89	277	391	0.397	0.386	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
8	A0A0A0MQW3	1.84e-89	277	400	0.397	0.378	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
9	Q96P63	1.31e-88	275	405	0.418	0.393	SPB12_HUMAN Serpin B12 OS=Homo sapiens OX=9606 GN=SERPINB12 PE=1 SV=1
10	Q8BHL1	4.50e-87	270	387	0.376	0.370	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
11	P29508	2.00e-86	269	390	0.429	0.418	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
12	Q6UKZ2	3.46e-86	268	387	0.374	0.367	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
13	Q9D1Q5	4.12e-86	268	387	0.376	0.370	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
14	P48594	4.91e-86	268	390	0.421	0.410	SPB4_HUMAN Serpin B4 OS=Homo sapiens OX=9606 GN=SERPINB4 PE=1 SV=2
15	A2RSF9	6.49e-86	267	386	0.371	0.365	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
16	Q9D154	5.20e-85	265	379	0.382	0.383	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
17	P01012	1.26e-84	264	386	0.355	0.350	OVAL_CHICK Ovalbumin OS=Gallus gallus OX=9031 GN=SERPINB14 PE=1 SV=2
18	Q8VHP7	5.92e-84	262	382	0.400	0.398	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
19	Q6UKZ1	3.09e-83	260	386	0.361	0.355	Q6UKZ1_MOUSE Serpinb3c OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
20	P30740	5.45e-83	259	379	0.395	0.396	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	6.6e-115	396.0	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381101

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229135	0.643	Interferon gamma
2	9606.ENSP00000231449	0.643	Interleukin-4
3	9606.ENSP00000011653	0.642	T-cell surface glycoprotein CD4
4	9606.ENSP00000231454	0.642	Interleukin-5
5	9606.ENSP00000304915	0.642	Interleukin-13
6	9606.ENSP00000398698	0.640	Tumor necrosis factor
7	9606.ENSP00000412237	0.636	Interleukin-10
8	9606.ENSP00000454623	0.633	Integrin alpha-X
9	9606.ENSP00000282406	0.630	Pleckstrin homology domain-containing family H member 2
10	9606.ENSP00000435550	0.624	Zinc finger C2HC-type containing 1C
11	9606.ENSP00000385675	0.613	Interleukin-6
12	9606.ENSP00000365380	0.612	Forkhead box protein P3
13	9606.ENSP00000257198	0.611	Desmocollin-1
14	9606.ENSP00000226730	0.610	Interleukin-2
15	9606.ENSP00000312185	0.603	Engulfment and cell motility protein 1
16	9606.ENSP00000295897	0.599	Serum albumin
17	9606.ENSP00000296871	0.566	Granulocyte-macrophage colony-stimulating factor
18	9606.ENSP00000344192	0.558	Interleukin-17A
19	9606.ENSP00000332049	0.553	T-lymphocyte activation antigen CD86
20	9606.ENSP00000369293	0.553	Interleukin-2 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005488	0.995	binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0019222	0.994	regulation of metabolic process
GO:0048518	0.984	positive regulation of biological process
GO:0001817	0.980	regulation of cytokine production
GO:0010712	0.964	regulation of collagen metabolic process
GO:0071634	0.964	regulation of transforming growth factor beta production
GO:0050794	0.957	regulation of cellular process
GO:0009893	0.957	positive regulation of metabolic process
GO:0010604	0.862	positive regulation of macromolecule metabolic process
GO:0048522	0.847	positive regulation of cellular process
GO:0010628	0.785	positive regulation of gene expression
GO:0009987	0.768	cellular process
GO:0001819	0.755	positive regulation of cytokine production
GO:0042127	0.749	regulation of cell population proliferation
GO:0009889	0.715	regulation of biosynthetic process
GO:0010714	0.715	positive regulation of collagen metabolic process
GO:0032965	0.688	regulation of collagen biosynthetic process
GO:0050896	0.671	response to stimulus
GO:0032967	0.638	positive regulation of collagen biosynthetic process
GO:0080090	0.370	regulation of primary metabolic process
GO:0032501	0.322	multicellular organismal process
GO:0008284	0.315	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0005622	0.993	intracellular anatomical structure
GO:0005576	0.981	extracellular region
GO:0043229	0.953	intracellular organelle
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0012505	0.926	endomembrane system
GO:0005737	0.917	cytoplasm
GO:0005615	0.884	extracellular space
GO:0031982	0.599	vesicle
GO:0005829	0.591	cytosol
GO:0097708	0.377	intracellular vesicle
GO:0031410	0.349	cytoplasmic vesicle
GO:0031090	0.338	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]