StarFunc result for job id O75643

User Input

>input (2136 residues)
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFL
YQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIY
IAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG
GERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYED
VATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPY
GFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGR
WTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDM
LNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSL
SSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMAD
MVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVV
KKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFE
PLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESL
YQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYIT
PMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDV
AHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVI
VFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYL
HEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEI
VTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSK
CISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPI
RHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVE
SVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQ
LEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATG
AHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3jcmN	0.686	0.851	0.000	1686	0.348	0.441	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
2	PDB:5dcaA	0.855	0.936	0.000	1948	0.381	0.418	5dcaA.pdb.gz
3	PDB:6qw65B	0.837	0.893	0.000	2001	0.935	0.999	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
4	AFDB:O48534	0.917	0.902	0.000	2172	0.563	0.553	O48534.pdb.gz	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
5	AFDB:O60072	0.790	0.869	0.000	1935	0.343	0.379	O60072.pdb.gz	SLH1_SCHPO RQC trigger complex helicase slh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slh1 PE=1 SV=1
6	AFDB:O75643	1.000	1.000	0.000	2136	1.000	1.000	O75643.pdb.gz	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
7	AFDB:P32639	0.879	0.869	0.000	2163	0.400	0.395	P32639.pdb.gz	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
8	AFDB:Q582D6	0.799	0.764	0.000	2237	0.291	0.278	Q582D6.pdb.gz	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
9	AFDB:Q8N3C0	0.840	0.816	0.000	2202	0.391	0.380	Q8N3C0.pdb.gz	ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3
10	AFDB:Q9FNQ1	0.859	0.851	0.000	2157	0.392	0.388	Q9FNQ1.pdb.gz	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
11	AFDB:Q9SYP1	0.913	0.898	0.000	2171	0.578	0.568	Q9SYP1.pdb.gz	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
12	AFDB:Q9UT24	0.899	0.883	0.000	2176	0.487	0.478	Q9UT24.pdb.gz	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
13	AFDB:Q9VUV9	0.910	0.907	0.000	2142	0.744	0.742	Q9VUV9.pdb.gz	U520_DROME U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=Brr2 PE=2 SV=4
14	PDB:6d6qM	0.220	0.602	2.170E-19	709	0.062	0.186	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
15	PDB:2xgjB	0.201	0.499	5.086E-18	777	0.064	0.175	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
16	PDB:6ro1A	0.170	0.374	9.312E-18	919	0.070	0.162	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
17	PDB:6iegA	0.194	0.435	7.409E-17	872	0.061	0.149	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
18	PDB:7z4yB	0.170	0.366	2.953E-16	930	0.059	0.134	7z4yB.pdb.gz
19	PDB:7qdyA	0.204	0.350	2.674E-15	1169	0.075	0.138	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
20	PDB:4xgtA	0.167	0.352	6.918E-15	961	0.053	0.119	4xgtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1A5	0.0	2843	1375	0.644	1.000	A0A494C1A5_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase (Fragment) OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=1
2	O48534	0.0	2419	2172	0.568	0.558	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
3	O60072	0.0	1380	1935	0.340	0.376	SLH1_SCHPO RQC trigger complex helicase slh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slh1 PE=1 SV=1
4	O75643	0.0	4437	2136	1.000	1.000	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
5	P32639	0.0	1533	2163	0.404	0.399	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
6	P53327	0.0	1274	1967	0.323	0.351	SLH1_YEAST RQC trigger complex helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLH1 PE=1 SV=2
7	Q582D6	0.0	852	2237	0.266	0.254	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
8	Q8N3C0	0.0	1575	2202	0.383	0.371	ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3
9	Q961L2	0.0	719	774	0.162	0.448	Q961L2_DROME GH18520p OS=Drosophila melanogaster OX=7227 GN=obe PE=2 SV=1
10	Q9FNQ1	0.0	1629	2157	0.380	0.376	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
11	Q9SYP1	0.0	2475	2171	0.580	0.570	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
12	Q9UT24	0.0	2102	2176	0.492	0.483	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
13	Q9VF56	0.0	1462	2183	0.348	0.340	Q9VF56_DROME Obelus OS=Drosophila melanogaster OX=7227 GN=obe PE=1 SV=2
14	Q9VUV9	0.0	3383	2142	0.747	0.745	U520_DROME U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=Brr2 PE=2 SV=4
15	D3Z4R1	1.34e-97	350	1434	0.125	0.187	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
16	B6DMK2	1.41e-85	310	1205	0.114	0.202	MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=MER3 PE=2 SV=1
17	Q5D892	3.35e-81	295	1133	0.093	0.175	MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana OX=3702 GN=MER3 PE=2 SV=1
18	Q381X2	2.46e-74	277	1408	0.110	0.167	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
19	P51979	5.26e-73	271	1187	0.108	0.194	HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFM1 PE=1 SV=3
20	O75417	3.24e-33	144	2590	0.070	0.058	DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens OX=9606 GN=POLQ PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	7.6e+02	11.3	AAA domain
2	PF13401 AAA_22	0.00032	32.4	AAA domain
3	PF13604 AAA_30	0.0001	33.6	AAA domain
4	PF00270 DEAD	9.8e-49	177.0	DEAD/DEAH box helicase
5	PF04645 DUF603	59	14.8	Protein of unknown function, DUF603
6	PF00271 Helicase_C	5.2e-10	51.0	Helicase conserved C-terminal domain
7	PF18149 Helicase_PWI	2.6e-34	129.2	N-terminal helicase PWI domain
8	PF20470 HTH_61	13	17.7	Helix-turn-helix domain
9	PF01695 IstB_IS21	20	16.1	IstB-like ATP binding protein
10	PF02562 PhoH	0.8	20.7	PhoH-like protein
11	PF04851 ResIII	1.5e-22	91.9	Type III restriction enzyme, res subunit
12	PF02889 Sec63	7.3e-175	590.8	Sec63 Brl domain
13	PF14532 Sigma54_activ_2	1.2e+02	14.3	Sigma-54 interaction domain
14	PF00580 UvrD-helicase	2.9e+02	12.3	UvrD/REP helicase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010360379.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351960.1	0.999	Small nuclear ribonucleoprotein U5 subunit 40
2	61622.XP_010352299.1	0.999	Elongation factor Tu GTP binding domain containing 2
3	61622.XP_010363595.1	0.999	pre-mRNA-processing factor 6
4	61622.XP_010364746.1	0.999	Squamous cell carcinoma antigen recognized by T-cells 1
5	61622.XP_010366557.1	0.999	CWC27 spliceosome associated protein homolog
6	61622.XP_010371814.1	0.999	pre-mRNA processing factor 8
7	61622.XP_010379922.1	0.999	Splicing factor 3b subunit 1
8	61622.XP_010381220.1	0.998	CWC22 spliceosome associated protein homolog
9	61622.XP_010381248.1	0.998	Splicing factor 3B subunit 3
10	61622.XP_010364735.1	0.997	Splicing factor 3b subunit 2
11	61622.XP_010366510.1	0.997	DEAH-box helicase 16
12	61622.XP_010368760.1	0.997	pre-mRNA processing factor 4
13	61622.XP_010378996.1	0.997	pre-mRNA processing factor 31
14	61622.XP_010383377.1	0.997	XPA binding protein 2
15	61622.XP_010385569.1	0.997	pre-mRNA processing factor 3
16	61622.XP_010373467.1	0.996	SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
17	61622.XP_010379981.1	0.996	Small nuclear ribonucleoprotein polypeptide A
18	61622.XP_010383734.1	0.996	DEAD-box helicase 23
19	61622.XP_010350986.1	0.995	Splicing factor 3A subunit 3
20	61622.XP_010353183.1	0.995	Small nuclear ribonucleoprotein Sm D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0003723	0.999	RNA binding
GO:0003724	0.999	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0010467	0.992	gene expression
GO:0016070	0.988	RNA metabolic process
GO:0008380	0.977	RNA splicing
GO:0000398	0.965	mRNA splicing, via spliceosome
GO:0022618	0.959	ribonucleoprotein complex assembly
GO:0032501	0.845	multicellular organismal process
GO:0001503	0.548	ossification
GO:0050789	0.497	regulation of biological process
GO:0032502	0.481	developmental process
GO:0045292	0.439	mRNA cis splicing, via spliceosome
GO:0019222	0.398	regulation of metabolic process
GO:0060255	0.392	regulation of macromolecule metabolic process
GO:0050794	0.367	regulation of cellular process
GO:0010468	0.314	regulation of gene expression
GO:0080090	0.313	regulation of primary metabolic process
GO:0051171	0.313	regulation of nitrogen compound metabolic process
GO:0000245	0.307	spliceosomal complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:1990904	0.990	ribonucleoprotein complex
GO:0140513	0.982	nuclear protein-containing complex
GO:0120114	0.953	Sm-like protein family complex
GO:0016020	0.946	membrane
GO:0005681	0.885	spliceosomal complex
GO:1902494	0.868	catalytic complex
GO:0030532	0.868	small nuclear ribonucleoprotein complex
GO:0005684	0.857	U2-type spliceosomal complex
GO:0005737	0.762	cytoplasm
GO:0097525	0.725	spliceosomal snRNP complex
GO:0071013	0.635	catalytic step 2 spliceosome
GO:0071011	0.564	precatalytic spliceosome
GO:0005682	0.525	U5 snRNP
GO:0097526	0.511	spliceosomal tri-snRNP complex
GO:0046540	0.503	U4/U6 x U5 tri-snRNP complex
GO:0071005	0.418	U2-type precatalytic spliceosome
GO:0071012	0.402	catalytic step 1 spliceosome
GO:0071006	0.366	U2-type catalytic step 1 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.999	RNA helicase.

[back to server]