StarFunc result for job id O75663

User Input

>input (272 residues)
MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHG
SGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTL
LGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFF
LLLRFFLRIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQ
YLPIKEAVCEKLIFPERIDPNPADSQKSTQVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75663	1.000	1.000	1.196E-51	272	1.000	1.000	O75663.pdb.gz	TIPRL_HUMAN TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL PE=1 SV=2
2	AFDB:F1QRY4	0.939	0.949	7.529E-41	269	0.658	0.665	F1QRY4.pdb.gz	F1QRY4_DANRE TIP41-like protein OS=Danio rerio OX=7955 GN=zgc:66327 PE=1 SV=1
3	AFDB:C8V089	0.847	0.824	1.811E-25	280	0.393	0.382	C8V089.pdb.gz	C8V089_EMENI TipA protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05814 PE=3 SV=1
4	AFDB:Q8VXY4	0.802	0.755	1.194E-23	290	0.371	0.348	Q8VXY4.pdb.gz	TIPRL_ARATH TIP41-like protein OS=Arabidopsis thaliana OX=3702 GN=TIP41L PE=2 SV=1
5	AFDB:A0A1D8PNZ9	0.796	0.562	2.939E-23	393	0.386	0.267	A0A1D8PNZ9.pdb.gz	A0A1D8PNZ9_CANAL Tip41p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIP41 PE=3 SV=1
6	AFDB:Q9USK5	0.842	0.905	2.873E-22	252	0.283	0.306	Q9USK5.pdb.gz	TIP41_SCHPO Type 2A phosphatase activator tip41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tip41 PE=2 SV=1
7	AFDB:Q12199	0.757	0.590	1.026E-21	356	0.335	0.256	Q12199.pdb.gz	TIP41_YEAST Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIP41 PE=1 SV=1
8	AFDB:Q57VD8	0.731	0.361	9.872E-18	576	0.232	0.109	Q57VD8.pdb.gz	Q57VD8_TRYB2 GAF domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.220 PE=3 SV=1
9	AFDB:Q8IRK0	0.169	0.126	1.397E-2	462	0.132	0.078	Q8IRK0.pdb.gz	Q8IRK0_DROME GH04558p OS=Drosophila melanogaster OX=7227 GN=pio PE=2 SV=1
10	PDB:4mmhA	0.178	0.097	7.368E-2	637	0.121	0.052	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
11	AFDB:O49929	0.138	0.173	1.105E-1	213	0.110	0.141	O49929.pdb.gz	OEP24_PEA Outer envelope pore protein 24, chloroplastic OS=Pisum sativum OX=3888 GN=OEP24 PE=1 SV=1
12	PDB:3pgrA	0.162	0.123	2.494E-1	376	0.085	0.061	3pgrA.pdb.gz	From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
13	PDB:2p4bB	0.109	0.103	3.252E-1	260	0.096	0.100	2p4bB.pdb.gz
14	PDB:1af6A	0.117	0.082	5.525E-1	421	0.092	0.059	1af6A.pdb.gz	Channel specificity: structural basis for sugar discrimination and differential flux rates in maltoporin.
15	PDB:7fikj	0.112	0.044	5.826E-1	1028	0.107	0.028	7fikj.pdb.gz
16	PDB:6cd2C	0.172	0.076	7.594E-1	727	0.099	0.037	6cd2C.pdb.gz
17	PDB:6o09F	0.066	0.069	8.444E-1	262	0.040	0.042	6o09F.pdb.gz	ATXR5/6 Forms Alternative Protein Complexes with PCNA and the Nucleosome Core Particle.
18	PDB:2d73A	0.241	0.114	8.904E-1	717	0.051	0.020	2d73A.pdb.gz	Structural and functional analysis of a glycoside hydrolase family 97 enzyme from Bacteroides thetaiotaomicron.
19	PDB:7wb4j	0.122	0.048	1.044	995	0.121	0.033	7wb4j.pdb.gz
20	PDB:7lhhC	0.153	0.064	1.101	806	0.092	0.031	7lhhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75663	0.0	568	272	1.000	1.000	TIPRL_HUMAN TIP41-like protein OS=Homo sapiens OX=9606 GN=TIPRL PE=1 SV=2
2	F1QRY4	1.64e-128	367	269	0.654	0.662	F1QRY4_DANRE TIP41-like protein OS=Danio rerio OX=7955 GN=zgc:66327 PE=1 SV=1
3	C8V089	1.21e-49	167	280	0.393	0.382	C8V089_EMENI TipA protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05814 PE=3 SV=1
4	Q8VXY4	9.19e-47	159	290	0.371	0.348	TIPRL_ARATH TIP41-like protein OS=Arabidopsis thaliana OX=3702 GN=TIP41L PE=2 SV=1
5	A0A1D8PNZ9	3.91e-42	150	393	0.386	0.267	A0A1D8PNZ9_CANAL Tip41p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TIP41 PE=3 SV=1
6	Q12199	1.63e-36	134	356	0.342	0.261	TIP41_YEAST Type 2A phosphatase activator TIP41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIP41 PE=1 SV=1
7	Q9USK5	7.33e-36	130	252	0.287	0.310	TIP41_SCHPO Type 2A phosphatase activator tip41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tip41 PE=2 SV=1
8	Q57VD8	1.33e-18	87.4	576	0.228	0.108	Q57VD8_TRYB2 GAF domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.220 PE=3 SV=1
9	P30926	0.93	33.5	498	0.074	0.040	ACHB4_HUMAN Neuronal acetylcholine receptor subunit beta-4 OS=Homo sapiens OX=9606 GN=CHRNB4 PE=1 SV=2
10	Q9TS33	2.1	32.3	4872	0.074	0.004	RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus OX=9986 GN=RYR3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04176 TIP41	1.2e-62	221.9	TIP41-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356807

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
2	9606.ENSP00000279387	0.981	Serine/threonine-protein phosphatase 4 catalytic subunit
3	9606.ENSP00000363661	0.979	Immunoglobulin-binding protein 1
4	9606.ENSP00000392147	0.978	Protein phosphatase 6 catalytic subunit
5	9606.ENSP00000377036	0.923	Serine/threonine-protein phosphatase 2A activator
6	9606.ENSP00000221138	0.882	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
7	9606.ENSP00000382021	0.852	Leucine carboxyl methyltransferase 1
8	9606.ENSP00000414202	0.851	Serine/threonine-protein phosphatase 6 regulatory subunit 1
9	9606.ENSP00000377390	0.830	Serine/threonine-protein phosphatase 6 regulatory subunit 3
10	9606.ENSP00000478417	0.798	Serine/threonine-protein phosphatase 6 regulatory subunit 2
11	9606.ENSP00000349124	0.793	Serine/threonine-protein phosphatase 4 regulatory subunit 2
12	9606.ENSP00000324804	0.769	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
13	9606.ENSP00000483228	0.764	Serine/threonine-protein phosphatase 4 regulatory subunit 3B
14	9606.ENSP00000403925	0.748	Tubulin-specific chaperone cofactor E-like protein
15	9606.ENSP00000376543	0.692	Alpha-tectorin
16	9606.ENSP00000353098	0.687	Mini-chromosome maintenance complex-binding protein
17	9606.ENSP00000484532	0.679	Protein MIS12 homolog
18	9606.ENSP00000365233	0.678	Tripeptidyl-peptidase 2
19	9606.ENSP00000262746	0.650	Peroxiredoxin-1
20	9606.ENSP00000301522	0.636	Peroxiredoxin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0048523	0.983	negative regulation of cellular process
GO:0080090	0.974	regulation of primary metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0031323	0.973	regulation of cellular metabolic process
GO:0019220	0.959	regulation of phosphate metabolic process
GO:0035303	0.954	regulation of dephosphorylation
GO:0051716	0.941	cellular response to stimulus
GO:0050790	0.937	regulation of catalytic activity
GO:0051246	0.930	regulation of protein metabolic process
GO:0035304	0.900	regulation of protein dephosphorylation
GO:0035556	0.883	intracellular signal transduction
GO:0010921	0.878	regulation of phosphatase activity
GO:0031324	0.825	negative regulation of cellular metabolic process
GO:0006950	0.790	response to stress
GO:0010605	0.768	negative regulation of macromolecule metabolic process
GO:0051172	0.767	negative regulation of nitrogen compound metabolic process
GO:0051726	0.763	regulation of cell cycle
GO:0010564	0.742	regulation of cell cycle process
GO:0045936	0.729	negative regulation of phosphate metabolic process
GO:0010948	0.728	negative regulation of cell cycle process
GO:1901987	0.715	regulation of cell cycle phase transition
GO:0035305	0.714	negative regulation of dephosphorylation
GO:0051248	0.680	negative regulation of protein metabolic process
GO:0044092	0.675	negative regulation of molecular function
GO:0033554	0.644	cellular response to stress
GO:0000075	0.627	cell cycle checkpoint signaling
GO:0042770	0.616	signal transduction in response to DNA damage
GO:0031570	0.616	DNA integrity checkpoint signaling
GO:0031400	0.603	negative regulation of protein modification process
GO:0035308	0.592	negative regulation of protein dephosphorylation
GO:0043666	0.584	regulation of phosphoprotein phosphatase activity
GO:0000077	0.547	DNA damage checkpoint signaling
GO:0043086	0.467	negative regulation of catalytic activity
GO:0008152	0.351	metabolic process
GO:0010923	0.335	negative regulation of phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.958	nucleus
GO:0005829	0.869	cytosol
GO:0070013	0.520	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]