StarFunc result for job id O75665

User Input

>input (1012 residues)
MMAQSNMFTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPR
SISVEGSSLLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPT
SSLYKSLVSGSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLID
DQFADAYPQRIKFESLEIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEK
ELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGRE
AELKQRVEAFELNQKLQEEKHKSITEALRRQEQNIKSFEETYDRKLKNELLKYQLELKDD
YIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAI
TKQNHMLNEKVKEMSDYSLLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELA
VFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVA
DLKLQLKQTQTALENEVYCNPKQSVIDRSVNGLINGNVVPCNGEISGDFLNNPFKQENVL
ARMVASRITNYPTAWVEGSSPDSDLEFVANTKARVKELQQEAERLEKAFRSYHRRVIKNS
AKSPLAAKSPPSLHLLEAFKNITSSSPERHIFGEDRVVSEQPQVGTLEERNDVVEALTGS
AASRLRGGTSSRRLSSTPLPKAKRSLESEMYLEGLGRSHIASPSPCPDRMPLPSPTESRH
SLSIPPVSSPPEQKVGLYRRQTELQDKSEFSDVDKLAFKDNEEFESSFESAGNMPRQLEM
GGLSPAGDMSHVDAAAAAVPLSYQHPSVDQKQIEEQKEEEKIREQQVKERRQREERRQSN
LQEVLERERRELEKLYQERKMIEESLKIKIKKELEMENELEMSNQEIKDKSAHSENPLEK
YMKIIQQEQDQESADKSSKKMVQEGSLVDTLQSSDKVESLTGFSHEELDDSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZUD5	0.255	0.253	1.090E-85	1025	0.702	0.693	D3ZUD5.pdb.gz	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2
2	AFDB:Q80Z25	0.439	0.437	5.569E-85	1017	0.670	0.667	Q80Z25.pdb.gz	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
3	AFDB:Q7SZK7	0.282	0.311	1.495E-40	901	0.331	0.372	Q7SZK7.pdb.gz	OFD1_DANRE Centriole and centriolar satellite protein ofd1 OS=Danio rerio OX=7955 GN=ofd1 PE=2 SV=1
4	AFDB:A0A0G2K3L9	0.081	0.068	2.674E-8	1226	0.157	0.130	A0A0G2K3L9.pdb.gz	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
5	AFDB:B8QI33	0.116	0.101	2.674E-8	1267	0.153	0.122	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
6	AFDB:O75334	0.052	0.044	6.043E-8	1257	0.167	0.134	O75334.pdb.gz	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
7	AFDB:B2RXW8	0.069	0.059	9.981E-8	1241	0.160	0.131	B2RXW8.pdb.gz	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
8	AFDB:O75145	0.083	0.072	5.098E-7	1194	0.143	0.121	O75145.pdb.gz	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
9	AFDB:I0J0E7	0.117	0.099	7.427E-7	1217	0.153	0.127	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
10	AFDB:P85120	0.124	0.074	8.420E-7	2058	0.142	0.070	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
11	PDB:2yhsA	0.049	0.129	1.701	308	0.016	0.052	2yhsA.pdb.gz
12	PDB:7suk6	0.039	0.093	1.811	277	0.029	0.105	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
13	PDB:6qdvL	0.030	0.139	2.053	144	0.018	0.125	6qdvL.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
14	PDB:3iqcA	0.049	0.268	2.186	119	0.015	0.126	3iqcA.pdb.gz
15	PDB:7dcoL	0.072	0.143	2.328	435	0.045	0.106	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:7psqG	0.051	0.235	2.639	108	0.020	0.185	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
17	PDB:7ungB0	0.038	0.131	2.810	193	0.031	0.161	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:5exrB	0.049	0.094	2.992	434	0.020	0.046	5exrB.pdb.gz	Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome.
19	PDB:6u3eA	0.061	0.107	2.992	397	0.022	0.055	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
20	PDB:7b93p	0.032	0.128	2.992	171	0.028	0.164	7b93p.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I3Q5R3	0.0	1292	1181	0.698	0.598	A0A8I3Q5R3_CANLF LisH domain-containing protein OS=Canis lupus familiaris OX=9615 GN=OFD1 PE=1 SV=1
2	A0A8I6AA62	0.0	1252	1036	0.693	0.677	A0A8I6AA62_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=4 SV=1
3	D3ZUD5	0.0	1276	1027	0.703	0.692	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2
4	E9KL37	0.0	2055	1012	1.000	1.000	E9KL37_HUMAN Epididymis tissue sperm binding protein Li 5a OS=Homo sapiens OX=9606 GN=OFD1 PE=2 SV=1
5	G3I183	0.0	1229	957	0.639	0.676	G3I183_CRIGR Oral-facial-digital syndrome 1 protein-like OS=Cricetulus griseus OX=10029 GN=I79_017133 PE=1 SV=1
6	O75665	0.0	2055	1012	1.000	1.000	OFD1_HUMAN Centriole and centriolar satellite protein OFD1 OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1
7	Q80Z25	0.0	1236	1017	0.666	0.663	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
8	Q7SZK7	1.05e-135	432	901	0.302	0.340	OFD1_DANRE Centriole and centriolar satellite protein ofd1 OS=Danio rerio OX=7955 GN=ofd1 PE=2 SV=1
9	A6NF31	4.32e-90	285	143	0.135	0.958	A6NF31_HUMAN OFD1 centriole and centriolar satellite protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=2
10	Q9UPN4	0.30	37.7	1083	0.064	0.060	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
11	E9PN67	0.57	36.6	1989	0.047	0.024	E9PN67_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
12	Q8N4C6	0.64	36.6	2090	0.047	0.023	NIN_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4
13	C9J066	0.65	36.6	2046	0.047	0.023	C9J066_HUMAN Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
14	Q8I0Z1	0.69	36.2	743	0.044	0.061	Q8I0Z1_CAEEL CARD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cccp-1 PE=2 SV=1
15	H9KV85	1.3	35.4	1581	0.047	0.030	H9KV85_HUMAN Ninein (Fragment) OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=1
16	Q9VTY8	2.8	34.7	1854	0.069	0.038	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
17	M9PI41	2.9	34.3	1858	0.069	0.038	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
18	Q12840	3.1	34.3	1032	0.027	0.026	KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2
19	F6ZDS4	3.8	33.9	2431	0.050	0.021	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
20	P33175	5.0	33.5	1027	0.027	0.026	KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus OX=10090 GN=Kif5a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08513 LisH	8.4	17.7	LisH
2	PF16045 LisH_2	7.2e-11	52.3	LisH
3	PF16765 Pim	4.2e+02	12.4	Pesticin immunity protein
4	PF11852 Pullul_strch_C	8.3e+02	10.9	Alpha-1,6-glucosidases, pullulanase-type, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228682	0.944	Zinc finger protein GLI1
2	9606.ENSP00000379258	0.935	Transcriptional activator GLI3
3	9606.ENSP00000390436	0.926	Zinc finger protein GLI2
4	9606.ENSP00000358918	0.911	Suppressor of fused homolog
5	9606.ENSP00000355250	0.910	Protein moonraker
6	9606.ENSP00000376686	0.898	Lebercilin
7	9606.ENSP00000255759	0.896	LisH domain-containing protein FOPNL
8	9606.ENSP00000334379	0.891	C2 domain-containing protein 3
9	9606.ENSP00000327077	0.889	Pericentriolar material 1 protein
10	9606.ENSP00000393583	0.859	Centrosomal protein of 131 kDa
11	9606.ENSP00000355499	0.857	Serologically defined colon cancer antigen 8
12	9606.ENSP00000323580	0.834	Intraflagellar transport protein 88 homolog
13	9606.ENSP00000287380	0.820	TBC1 domain family member 31
14	9606.ENSP00000317144	0.815	Progesterone-induced-blocking factor 1
15	9606.ENSP00000448012	0.808	Centrosomal protein of 290 kDa
16	9606.ENSP00000286688	0.801	Protein C8orf37
17	9606.ENSP00000264935	0.791	Centrosomal protein of 72 kDa
18	9606.ENSP00000262210	0.783	Centrosome and spindle pole-associated protein 1
19	9606.ENSP00000318297	0.777	RuvB-like 1
20	9606.ENSP00000257287	0.776	Centrosomal protein of 135 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.792	cytoskeletal protein binding
GO:0015631	0.752	tubulin binding
GO:0043014	0.739	alpha-tubulin binding
GO:0042802	0.703	identical protein binding
GO:0043015	0.586	gamma-tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060271	0.985	cilium assembly
GO:0065007	0.439	biological regulation
GO:0050794	0.425	regulation of cellular process
GO:0007017	0.422	microtubule-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0005815	0.996	microtubule organizing center
GO:0016020	0.994	membrane
GO:0005813	0.989	centrosome
GO:0005814	0.962	centriole
GO:0005929	0.933	cilium
GO:0036064	0.649	ciliary basal body
GO:0043231	0.394	intracellular membrane-bounded organelle
GO:0034451	0.376	centriolar satellite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]