StarFunc result for job id O75674

User Input

>input (476 residues)
MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRI
SKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRIL
NFIKTWSQGFPGGVDVSEVKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPT
APALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMSAILMENTPGSENHEDIELLQ
KLYKTGREMQERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQ
KEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPSSDVTNNLKPS
LHPQMNLLALENTEIPPFAQRTSQNLTSSHAYDNFLEHSNSVFLQPVSLQTIAAAPSNQS
LPPLPSNHPAMTKSDLQPPNYYEVMEFDPLAPAVTTEAIYEEIDAHQHKGAQNDGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75674	1.000	1.000	8.421E-57	476	1.000	1.000	O75674.pdb.gz	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
2	AFDB:Q923U0	0.348	0.349	1.102E-46	474	0.809	0.812	Q923U0.pdb.gz	TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus OX=10090 GN=Tom1l1 PE=1 SV=1
3	AFDB:Q6ZVM7	0.311	0.292	1.661E-20	507	0.273	0.256	Q6ZVM7.pdb.gz	TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1
4	AFDB:O60784	0.313	0.303	6.386E-20	492	0.263	0.254	O60784.pdb.gz	TOM1_HUMAN Target of Myb1 membrane trafficking protein OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2
5	AFDB:O88746	0.315	0.305	1.310E-19	492	0.277	0.268	O88746.pdb.gz	TOM1_MOUSE Target of Myb1 membrane trafficking protein OS=Mus musculus OX=10090 GN=Tom1 PE=1 SV=1
6	AFDB:F4JV51	0.276	0.198	6.951E-13	676	0.252	0.178	F4JV51.pdb.gz	F4JV51_ARATH ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=1 SV=1
7	AFDB:Q9NZ52	0.268	0.179	2.442E-12	723	0.206	0.136	Q9NZ52.pdb.gz	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
8	AFDB:Q6P5E6	0.283	0.226	3.609E-11	603	0.185	0.146	Q6P5E6.pdb.gz	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
9	AFDB:B2MVI1	0.215	0.164	8.539E-5	638	0.132	0.099	B2MVI1.pdb.gz	B2MVI1_LAMFL Epsin 1 (Fragment) OS=Lampetra fluviatilis OX=7748 PE=2 SV=1
10	AFDB:Q9H201	0.220	0.171	5.142E-4	632	0.145	0.109	Q9H201.pdb.gz	EPN3_HUMAN Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1
11	PDB:7oo3c	0.243	0.724	1.774E-2	141	0.042	0.142	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:3gniA	0.149	0.188	1.855E-2	335	0.080	0.113	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
13	PDB:6l4oA	0.111	0.120	7.132E-2	429	0.069	0.077	6l4oA.pdb.gz
14	PDB:4a0cA	0.157	0.077	1.600E-1	1155	0.065	0.027	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:5tbkA	0.124	0.134	2.002E-1	417	0.084	0.096	5tbkA.pdb.gz
16	PDB:3gjxA	0.136	0.076	2.396E-1	1041	0.120	0.055	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
17	PDB:7wjiA	0.192	0.063	2.396E-1	1763	0.086	0.023	7wjiA.pdb.gz
18	PDB:7cunG	0.115	0.073	2.742E-1	895	0.101	0.054	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
19	PDB:2btpA	0.135	0.219	2.867E-1	248	0.076	0.145	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
20	PDB:4tnmA	0.190	0.215	2.867E-1	407	0.063	0.074	4tnmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75674	0.0	981	476	1.000	1.000	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
2	Q923U0	0.0	751	474	0.809	0.812	TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus OX=10090 GN=Tom1l1 PE=1 SV=1
3	Q6ZVM7	3.24e-74	244	507	0.286	0.268	TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1
4	O88746	9.92e-74	242	492	0.288	0.278	TOM1_MOUSE Target of Myb1 membrane trafficking protein OS=Mus musculus OX=10090 GN=Tom1 PE=1 SV=1
5	O60784	1.32e-72	239	492	0.296	0.287	TOM1_HUMAN Target of Myb1 membrane trafficking protein OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2
6	Q6NQK0	7.07e-18	88.2	446	0.141	0.150	TOL4_ARATH TOM1-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=TOL4 PE=1 SV=1
7	F4JV51	1.09e-17	88.2	676	0.155	0.109	F4JV51_ARATH ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=1 SV=1
8	Q8L860	1.10e-17	88.2	675	0.155	0.110	TOL9_ARATH TOM1-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=TOL9 PE=1 SV=1
9	Q9UJY4	2.72e-15	80.9	613	0.151	0.117	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
10	Q9UJY5	6.72e-15	79.3	639	0.137	0.102	GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 PE=1 SV=1
11	O93436	9.77e-15	78.6	468	0.097	0.098	STAM2_CHICK Signal transducing adapter molecule 2 OS=Gallus gallus OX=9031 GN=STAM2 PE=1 SV=1
12	Q92783	1.11e-14	78.6	540	0.092	0.081	STAM1_HUMAN Signal transducing adapter molecule 1 OS=Homo sapiens OX=9606 GN=STAM PE=1 SV=3
13	O75886	1.17e-14	78.6	525	0.088	0.080	STAM2_HUMAN Signal transducing adapter molecule 2 OS=Homo sapiens OX=9606 GN=STAM2 PE=1 SV=1
14	P70297	1.76e-14	78.2	548	0.092	0.080	STAM1_MOUSE Signal transducing adapter molecule 1 OS=Mus musculus OX=10090 GN=Stam PE=1 SV=3
15	B5DF55	1.80e-14	77.8	547	0.092	0.080	B5DF55_RAT Signal transducing adaptor molecule OS=Rattus norvegicus OX=10116 GN=Stam PE=3 SV=1
16	A0A8I6A2K6	1.96e-14	77.8	545	0.092	0.081	A0A8I6A2K6_RAT Signal transducing adaptor molecule OS=Rattus norvegicus OX=10116 GN=Stam PE=1 SV=1
17	Q8R0H9	3.06e-14	77.4	635	0.128	0.096	GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus OX=10090 GN=Gga1 PE=1 SV=1
18	Q9NZ52	4.46e-14	77.0	723	0.139	0.091	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
19	Q6P5E6	8.16e-14	75.9	603	0.145	0.114	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
20	A0A0G2JTT5	2.72e-13	74.3	535	0.084	0.075	A0A0G2JTT5_RAT Signal transducing adaptor molecule OS=Rattus norvegicus OX=10116 GN=Stam PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03127 GAT	1.9e-13	61.8	GAT domain
2	PF01025 GrpE	4e+02	12.0	GrpE
3	PF00790 VHS	2.5e-27	106.9	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000460823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251968	0.932	Tumor susceptibility gene 101 protein
2	9606.ENSP00000376345	0.896	Growth factor receptor-bound protein 2
3	9606.ENSP00000479606	0.883	Clathrin heavy chain 1
4	9606.ENSP00000314733	0.850	Toll-interacting protein
5	9606.ENSP00000337159	0.816	Zinc finger FYVE domain-containing protein 16
6	9606.ENSP00000365530	0.765	Syntaxin-binding protein 4
7	9606.ENSP00000299335	0.759	Cytochrome c oxidase assembly protein COX11, mitochondrial
8	9606.ENSP00000346671	0.751	Tyrosine-protein kinase Fyn
9	9606.ENSP00000301765	0.729	Vacuolar protein sorting-associated protein 37C
10	9606.ENSP00000297265	0.717	Charged multivesicular body protein 4c
11	9606.ENSP00000261520	0.714	Little elongation complex subunit 2
12	9606.ENSP00000469240	0.679	Charged multivesicular body protein 2a
13	9606.ENSP00000317955	0.662	Early endosome antigen 1
14	9606.ENSP00000364945	0.645	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
15	9606.ENSP00000335076	0.630	Ectodysplasin-A receptor-associated adapter protein
16	9606.ENSP00000358417	0.629	D-3-phosphoglycerate dehydrogenase
17	9606.ENSP00000367299	0.619	Vacuolar protein-sorting-associated protein 36
18	9606.ENSP00000257861	0.617	Advillin
19	9606.ENSP00000327234	0.616	Transmembrane and coiled-coil domains 5A
20	9606.ENSP00000265634	0.612	Neuronal pentraxin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030276	0.999	clathrin binding
GO:0043130	0.998	ubiquitin binding
GO:0019899	0.997	enzyme binding
GO:0019901	0.926	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007154	0.980	cell communication
GO:0023052	0.978	signaling
GO:0050896	0.971	response to stimulus
GO:0051716	0.958	cellular response to stimulus
GO:0007165	0.946	signal transduction
GO:0051128	0.945	regulation of cellular component organization
GO:0019222	0.933	regulation of metabolic process
GO:0051726	0.929	regulation of cell cycle
GO:0031323	0.923	regulation of cellular metabolic process
GO:0048523	0.891	negative regulation of cellular process
GO:0048522	0.889	positive regulation of cellular process
GO:0080090	0.810	regulation of primary metabolic process
GO:0060255	0.793	regulation of macromolecule metabolic process
GO:0051171	0.783	regulation of nitrogen compound metabolic process
GO:0050790	0.768	regulation of catalytic activity
GO:0051174	0.751	regulation of phosphorus metabolic process
GO:0051246	0.739	regulation of protein metabolic process
GO:0051338	0.681	regulation of transferase activity
GO:0031399	0.669	regulation of protein modification process
GO:0019220	0.664	regulation of phosphate metabolic process
GO:0010564	0.658	regulation of cell cycle process
GO:0033043	0.603	regulation of organelle organization
GO:0001932	0.477	regulation of protein phosphorylation
GO:0009893	0.405	positive regulation of metabolic process
GO:0045859	0.355	regulation of protein kinase activity
GO:0007346	0.345	regulation of mitotic cell cycle
GO:0008152	0.335	metabolic process
GO:0051247	0.331	positive regulation of protein metabolic process
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0045786	0.304	negative regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005768	0.998	endosome
GO:0070062	0.997	extracellular exosome
GO:0005764	0.993	lysosome
GO:0016020	0.964	membrane
GO:0071944	0.841	cell periphery
GO:0031090	0.670	organelle membrane
GO:0030659	0.632	cytoplasmic vesicle membrane
GO:0010008	0.614	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]