StarFunc result for job id O75676

User Input

>input (772 residues)
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z2B9	0.578	0.578	0.000	773	0.960	0.959	Q9Z2B9.pdb.gz	KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus OX=10090 GN=Rps6ka4 PE=1 SV=2
2	AFDB:O75582	0.471	0.455	1.593E-94	802	0.642	0.618	O75582.pdb.gz	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
3	AFDB:Q8C050	0.463	0.417	1.502E-92	863	0.641	0.574	Q8C050.pdb.gz	KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus OX=10090 GN=Rps6ka5 PE=1 SV=2
4	AFDB:A0A384MDW3	0.392	0.408	1.280E-59	740	0.404	0.422	A0A384MDW3.pdb.gz	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:A0A0R4ID09	0.400	0.420	2.731E-59	733	0.407	0.428	A0A0R4ID09.pdb.gz	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
6	AFDB:Q15349	0.391	0.411	7.130E-59	733	0.391	0.412	Q15349.pdb.gz	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
7	AFDB:Q15418	0.393	0.412	6.259E-58	735	0.391	0.411	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
8	AFDB:Q9UK32	0.391	0.405	5.494E-57	745	0.392	0.407	Q9UK32.pdb.gz	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1
9	AFDB:Q7TPS0	0.380	0.384	5.335E-56	764	0.408	0.412	Q7TPS0.pdb.gz	KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus OX=10090 GN=Rps6ka6 PE=1 SV=2
10	AFDB:A0A2R8Q8Y4	0.398	0.442	6.530E-56	685	0.387	0.436	A0A2R8Q8Y4.pdb.gz
11	PDB:6byrA	0.344	0.645	5.141E-26	405	0.157	0.299	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:6s9wA	0.331	0.600	1.412E-25	411	0.168	0.316	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
13	PDB:3pvuA	0.339	0.426	6.426E-25	609	0.152	0.192	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
14	PDB:6hhgA	0.324	0.627	2.514E-24	386	0.167	0.334	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:4mk0A	0.336	0.409	2.925E-24	631	0.149	0.182	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3pfqA	0.358	0.523	3.236E-24	523	0.157	0.231	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
17	PDB:5kcvA	0.319	0.682	1.266E-23	353	0.152	0.331	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
18	PDB:5x3fB	0.319	0.684	1.803E-23	349	0.149	0.330	5x3fB.pdb.gz
19	PDB:6pjxA	0.348	0.488	6.060E-23	543	0.135	0.192	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:3c4wB	0.335	0.491	1.229E-22	519	0.140	0.208	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YYC0	0.0	1438	704	0.912	1.000	A0A0A6YYC0_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=5
2	A0A0R4ID09	0.0	556	733	0.418	0.441	A0A0R4ID09_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=id:ibd1103 PE=1 SV=1
3	A0A384MDW3	0.0	554	740	0.416	0.434	A0A384MDW3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 PE=2 SV=1
4	B4DG22	0.0	552	711	0.417	0.453	B4DG22_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
5	B7ZB17	0.0	553	712	0.416	0.451	B7ZB17_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
6	E9PJN1	0.0	1559	765	0.991	1.000	E9PJN1_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=1
7	O75582	0.0	1035	802	0.633	0.610	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
8	O75676	0.0	1581	772	1.000	1.000	KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4 PE=1 SV=1
9	P18654	0.0	553	740	0.416	0.434	KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus OX=10090 GN=Rps6ka3 PE=1 SV=2
10	P51812	0.0	554	740	0.416	0.434	KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1
11	Q15349	0.0	547	733	0.402	0.423	KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens OX=9606 GN=RPS6KA2 PE=1 SV=2
12	Q15418	0.0	553	735	0.408	0.429	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
13	Q63531	0.0	557	735	0.408	0.429	KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus OX=10116 GN=Rps6ka1 PE=1 SV=1
14	Q7ZVH8	0.0	555	732	0.417	0.440	Q7ZVH8_DANRE Ribosomal protein S6 kinase OS=Danio rerio OX=7955 GN=rps6ka3 PE=1 SV=1
15	Q8C050	0.0	691	863	0.415	0.371	KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus OX=10090 GN=Rps6ka5 PE=1 SV=2
16	Q9PTN1	0.0	556	737	0.418	0.438	Q9PTN1_XENLA Ribosomal protein S6 kinase OS=Xenopus laevis OX=8355 GN=rps6ka3.L PE=1 SV=1
17	Q9WUT3	0.0	551	733	0.403	0.424	KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus OX=10090 GN=Rps6ka2 PE=1 SV=1
18	Q9Z2B9	0.0	1486	773	0.961	0.960	KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus OX=10090 GN=Rps6ka4 PE=1 SV=2
19	P18653	1.42e-180	536	724	0.399	0.425	KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus OX=10090 GN=Rps6ka1 PE=1 SV=1
20	Q9UK32	1.44e-179	534	745	0.408	0.423	KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens OX=9606 GN=RPS6KA6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.9e-08	43.7	ABC1 atypical kinase-like domain
2	PF01636 APH	3.2e-06	38.7	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	44	15.1	Choline/ethanolamine kinase
4	PF13095 FTA2	0.61	21.3	Kinetochore Sim4 complex subunit FTA2
5	PF12330 Haspin_kinase	0.00081	30.1	Haspin like kinase domain
6	PF06293 Kdo	0.00025	32.0	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	1.3e-07	42.9	Kinase-like
8	PF00069 Pkinase	1.7e-129	442.4	Protein kinase domain
9	PF00433 Pkinase_C	0.035	26.1	Protein kinase C terminal domain
10	PF17667 Pkinase_fungal	6.8e-05	33.4	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	9.6e-58	207.1	Protein tyrosine and serine/threonine kinase
12	PF01163 RIO1	0.0065	27.6	RIO1 family
13	PF19974 TCAD9	15	16.1	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229795	0.991	Mitogen-activated protein kinase 14
2	9606.ENSP00000215832	0.972	Mitogen-activated protein kinase 1
3	9606.ENSP00000387699	0.966	Cyclic AMP-responsive element-binding protein 1
4	9606.ENSP00000263025	0.944	Mitogen-activated protein kinase 3
5	9606.ENSP00000262053	0.940	Cyclic AMP-dependent transcription factor ATF-1
6	9606.ENSP00000340691	0.937	Eukaryotic translation initiation factor 4E-binding protein 1
7	9606.ENSP00000333685	0.936	Mitogen-activated protein kinase 11
8	9606.ENSP00000435412	0.911	Ribosomal protein S6 kinase alpha-1
9	9606.ENSP00000262752	0.906	Ribosomal protein S6 kinase alpha-6
10	9606.ENSP00000368884	0.906	Ribosomal protein S6 kinase alpha-3
11	9606.ENSP00000427015	0.906	Ribosomal protein S6 kinase alpha-2
12	9606.ENSP00000479667	0.902	Ribosomal protein S6 kinase alpha-5
13	9606.ENSP00000215659	0.853	Mitogen-activated protein kinase 12
14	9606.ENSP00000364349	0.853	Cyclic AMP-dependent transcription factor ATF-6 beta
15	9606.ENSP00000211287	0.838	Mitogen-activated protein kinase 13
16	9606.ENSP00000336790	0.804	Cyclic AMP-dependent transcription factor ATF-4
17	9606.ENSP00000301019	0.726	DNA replication factor Cdt1
18	9606.ENSP00000462945	0.725	Male-specific lethal 1 homolog
19	9606.ENSP00000311827	0.691	E3 ubiquitin-protein ligase MSL2
20	9606.ENSP00000312244	0.679	Male-specific lethal 3 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0043168	0.993	anion binding
GO:0000166	0.985	nucleotide binding
GO:0005524	0.979	ATP binding
GO:0035173	0.702	histone kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0006807	0.988	nitrogen compound metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006468	0.976	protein phosphorylation
GO:0051716	0.968	cellular response to stimulus
GO:0007154	0.967	cell communication
GO:0080090	0.951	regulation of primary metabolic process
GO:0023052	0.946	signaling
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0048518	0.872	positive regulation of biological process
GO:0010468	0.872	regulation of gene expression
GO:0031323	0.849	regulation of cellular metabolic process
GO:0035556	0.788	intracellular signal transduction
GO:0019219	0.773	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.768	positive regulation of metabolic process
GO:0010604	0.760	positive regulation of macromolecule metabolic process
GO:0048522	0.688	positive regulation of cellular process
GO:0010556	0.623	regulation of macromolecule biosynthetic process
GO:0051252	0.538	regulation of RNA metabolic process
GO:0031325	0.513	positive regulation of cellular metabolic process
GO:0048519	0.511	negative regulation of biological process
GO:0031326	0.503	regulation of cellular biosynthetic process
GO:0006355	0.465	regulation of DNA-templated transcription
GO:0042221	0.455	response to chemical
GO:0048523	0.442	negative regulation of cellular process
GO:0051173	0.429	positive regulation of nitrogen compound metabolic process
GO:0009891	0.395	positive regulation of biosynthetic process
GO:0010557	0.389	positive regulation of macromolecule biosynthetic process
GO:0031328	0.389	positive regulation of cellular biosynthetic process
GO:0045935	0.377	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.365	positive regulation of nucleic acid-templated transcription
GO:0045893	0.363	positive regulation of DNA-templated transcription
GO:0070887	0.325	cellular response to chemical stimulus
GO:0006950	0.319	response to stress
GO:0006357	0.318	regulation of transcription by RNA polymerase II
GO:0010033	0.306	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]