StarFunc result for job id O75677

User Input

>input (317 residues)
MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVC
FKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICP
VINPGTTDAPVHPGEAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75677	1.000	1.000	1.038E-65	317	1.000	1.000	O75677.pdb.gz	RFPL1_HUMAN Ret finger protein-like 1 OS=Homo sapiens OX=9606 GN=RFPL1 PE=1 SV=2
2	AFDB:A6NLU0	0.849	0.934	1.528E-43	287	0.527	0.582	A6NLU0.pdb.gz	RFPLA_HUMAN Ret finger protein-like 4A OS=Homo sapiens OX=9606 GN=RFPL4A PE=1 SV=3
3	AFDB:Q8VH31	0.805	0.884	9.904E-39	287	0.486	0.537	Q8VH31.pdb.gz	RFPLA_MOUSE Ret finger protein-like 4A OS=Mus musculus OX=10090 GN=Rfpl4a PE=1 SV=1
4	AFDB:A0A1U9X8R9	0.575	0.358	2.886E-27	513	0.328	0.203	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
5	AFDB:P19474	0.576	0.390	3.280E-26	475	0.331	0.221	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
6	AFDB:Q5NCC9	0.569	0.374	5.156E-26	485	0.322	0.210	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
7	AFDB:Q62191	0.558	0.379	3.147E-25	470	0.315	0.213	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
8	AFDB:Q6AZZ1	0.559	0.368	4.946E-25	485	0.290	0.190	Q6AZZ1.pdb.gz	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
9	AFDB:Q86WT6	0.543	0.348	6.561E-25	500	0.322	0.204	Q86WT6.pdb.gz	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
10	AFDB:O00635	0.545	0.374	4.238E-24	465	0.312	0.213	O00635.pdb.gz	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
11	PDB:7y4sA	0.542	0.503	5.040E-17	343	0.164	0.152	7y4sA.pdb.gz
12	PDB:4b3nA	0.483	0.280	6.154E-15	557	0.164	0.093	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.345	0.628	3.521E-7	164	0.069	0.134	7ccbA.pdb.gz
14	PDB:7nscA	0.369	0.418	6.656E-6	276	0.079	0.091	7nscA.pdb.gz
15	PDB:7m6aA	0.300	0.026	2.894E-5	4306	0.095	0.007	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
16	PDB:7tdgA	0.275	0.024	3.628E-5	4134	0.073	0.006	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
17	PDB:7tzcA	0.302	0.025	2.214E-4	4404	0.088	0.006	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:6swy1	0.337	0.206	3.481E-4	542	0.082	0.048	6swy1.pdb.gz
19	PDB:7u9tA	0.310	0.027	3.897E-4	4229	0.085	0.006	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7cf9A	0.286	0.027	5.471E-4	3949	0.073	0.006	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75677	0.0	657	317	1.000	1.000	RFPL1_HUMAN Ret finger protein-like 1 OS=Homo sapiens OX=9606 GN=RFPL1 PE=1 SV=2
2	O75679	0.0	602	317	0.918	0.918	RFPL3_HUMAN Ret finger protein-like 3 OS=Homo sapiens OX=9606 GN=RFPL3 PE=1 SV=2
3	A6NLU0	6.71e-120	348	287	0.521	0.575	RFPLA_HUMAN Ret finger protein-like 4A OS=Homo sapiens OX=9606 GN=RFPL4A PE=1 SV=3
4	Q8VH31	3.09e-98	293	287	0.486	0.537	RFPLA_MOUSE Ret finger protein-like 4A OS=Mus musculus OX=10090 GN=Rfpl4a PE=1 SV=1
5	A0A0R4IUT0	1.84e-42	155	544	0.300	0.175	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
6	F8W6Z2	5.79e-42	155	601	0.249	0.131	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
7	O00478	7.60e-42	154	584	0.293	0.159	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
8	O15553	2.23e-41	155	781	0.249	0.101	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
9	A0A1U9X8R9	3.39e-41	151	513	0.256	0.158	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
10	P14373	3.39e-41	151	513	0.256	0.158	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
11	Q62158	4.29e-41	151	513	0.256	0.158	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
12	O00481	1.36e-39	147	513	0.237	0.146	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
13	P19474	5.03e-39	145	475	0.287	0.192	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
14	Q8BVP1	2.22e-38	143	470	0.246	0.166	TRIML_MOUSE Probable E3 ubiquitin-protein ligase TRIML1 OS=Mus musculus OX=10090 GN=Triml1 PE=1 SV=1
15	R4GMV1	5.55e-37	137	343	0.259	0.239	R4GMV1_HUMAN Tripartite motif containing 11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=1
16	Q96F44	2.76e-36	137	468	0.259	0.175	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
17	Q62556	9.69e-36	137	524	0.256	0.155	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
18	Q13410	1.04e-35	137	526	0.249	0.150	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
19	Q62191	1.26e-35	135	470	0.274	0.185	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
20	Q3U7K7	1.28e-35	135	462	0.274	0.188	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13765 PRY	8.7e-11	52.6	SPRY-associated domain
2	PF11002 RDM	6.4e-19	79.0	RFPL defining motif (RDM)
3	PF00622 SPRY	4.4e-14	64.0	SPRY domain
4	PF17430 YqgC	82	14.7	Uncharacterized YqgC-like
5	PF00097 zf-C3HC4	19	16.5	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	1e-13	62.5	zinc finger of C3HC4-type, RING
7	PF13445 zf-RING_UBOX	3.6e+02	12.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482492	0.911	Putative protein RFPL3S
2	9606.ENSP00000249007	0.667	Ret finger protein-like 3
3	9606.ENSP00000372651	0.637	FOXL2 neighbor
4	9606.ENSP00000404100	0.625	Paired box protein Pax-6
5	9606.ENSP00000367942	0.615	Growth/differentiation factor 9
6	9606.ENSP00000311997	0.588	Neurofilament heavy polypeptide
7	9606.ENSP00000321963	0.533	Zinc finger and SCAN domain-containing protein 4
8	9606.ENSP00000323355	0.526	Protein FAM187B
9	9606.ENSP00000433282	0.520	Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.963	positive regulation of cellular process
GO:0080090	0.960	regulation of primary metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0044093	0.928	positive regulation of molecular function
GO:0031323	0.903	regulation of cellular metabolic process
GO:0048523	0.892	negative regulation of cellular process
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0009987	0.784	cellular process
GO:0051345	0.752	positive regulation of hydrolase activity
GO:0051246	0.740	regulation of protein metabolic process
GO:0045862	0.709	positive regulation of proteolysis
GO:0009894	0.706	regulation of catabolic process
GO:2000116	0.703	regulation of cysteine-type endopeptidase activity
GO:0051726	0.697	regulation of cell cycle
GO:0031325	0.660	positive regulation of cellular metabolic process
GO:2001056	0.629	positive regulation of cysteine-type endopeptidase activity
GO:0031329	0.622	regulation of cellular catabolic process
GO:1903052	0.599	positive regulation of proteolysis involved in protein catabolic process
GO:0007346	0.596	regulation of mitotic cell cycle
GO:0032434	0.595	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1902749	0.594	regulation of cell cycle G2/M phase transition
GO:0009896	0.563	positive regulation of catabolic process
GO:0043281	0.563	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045786	0.553	negative regulation of cell cycle
GO:0032436	0.466	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043280	0.464	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010389	0.456	regulation of G2/M transition of mitotic cell cycle
GO:0045930	0.446	negative regulation of mitotic cell cycle
GO:0042127	0.444	regulation of cell population proliferation
GO:1902750	0.439	negative regulation of cell cycle G2/M phase transition
GO:0051782	0.437	negative regulation of cell division
GO:0050896	0.418	response to stimulus
GO:0010941	0.415	regulation of cell death
GO:0010942	0.401	positive regulation of cell death
GO:1901991	0.394	negative regulation of mitotic cell cycle phase transition
GO:0043067	0.393	regulation of programmed cell death
GO:0042981	0.381	regulation of apoptotic process
GO:0043068	0.381	positive regulation of programmed cell death
GO:0008152	0.315	metabolic process
GO:0043065	0.312	positive regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.947	organelle
GO:0043229	0.914	intracellular organelle
GO:0043231	0.696	intracellular membrane-bounded organelle
GO:0005634	0.630	nucleus
GO:0043232	0.321	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]