StarFunc result for job id O75679

User Input

>input (317 residues)
MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVC
LKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRM
RKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRH
YWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDR
KLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICP
LMNSGTTDAPVRPGEAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75677	0.851	0.851	4.784E-57	317	0.918	0.918	O75677.pdb.gz	RFPL1_HUMAN Ret finger protein-like 1 OS=Homo sapiens OX=9606 GN=RFPL1 PE=1 SV=2
2	AFDB:A6NLU0	0.832	0.915	1.002E-42	287	0.521	0.575	A6NLU0.pdb.gz	RFPLA_HUMAN Ret finger protein-like 4A OS=Homo sapiens OX=9606 GN=RFPL4A PE=1 SV=3
3	AFDB:Q8VH31	0.776	0.850	7.172E-39	287	0.473	0.523	Q8VH31.pdb.gz	RFPLA_MOUSE Ret finger protein-like 4A OS=Mus musculus OX=10090 GN=Rfpl4a PE=1 SV=1
4	AFDB:A0A1U9X8R9	0.580	0.363	6.456E-28	513	0.353	0.218	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
5	AFDB:P19474	0.577	0.391	1.679E-26	475	0.347	0.232	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
6	AFDB:Q5NCC9	0.568	0.374	6.111E-26	485	0.341	0.223	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
7	AFDB:A0A024RCR1	0.552	0.362	1.588E-25	488	0.328	0.213	A0A024RCR1.pdb.gz
8	AFDB:Q86WT6	0.539	0.346	1.588E-25	500	0.331	0.210	Q86WT6.pdb.gz	TRI69_HUMAN E3 ubiquitin-protein ligase TRIM69 OS=Homo sapiens OX=9606 GN=TRIM69 PE=1 SV=2
9	AFDB:Q62191	0.561	0.381	1.777E-25	470	0.328	0.221	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
10	AFDB:Q6P000	0.567	0.321	3.688E-25	564	0.344	0.193	Q6P000.pdb.gz
11	PDB:7y4sA	0.527	0.488	2.521E-17	343	0.177	0.163	7y4sA.pdb.gz
12	PDB:4b3nA	0.479	0.278	5.239E-15	557	0.174	0.099	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.374	0.684	1.713E-6	164	0.076	0.146	7ccbA.pdb.gz
14	PDB:7nscA	0.354	0.402	3.006E-5	276	0.082	0.094	7nscA.pdb.gz
15	PDB:7m6aA	0.327	0.027	8.264E-5	4306	0.088	0.007	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
16	PDB:6swy1	0.348	0.212	1.295E-4	542	0.098	0.057	6swy1.pdb.gz
17	PDB:7tzcA	0.315	0.026	2.689E-4	4404	0.085	0.006	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7tdgA	0.251	0.023	3.366E-4	4134	0.069	0.005	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
19	PDB:7u9tA	0.326	0.028	5.581E-4	4229	0.085	0.006	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7nsba	0.330	0.191	1.095E-3	568	0.076	0.042	7nsba.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75677	0.0	602	317	0.918	0.918	RFPL1_HUMAN Ret finger protein-like 1 OS=Homo sapiens OX=9606 GN=RFPL1 PE=1 SV=2
2	O75679	0.0	653	317	1.000	1.000	RFPL3_HUMAN Ret finger protein-like 3 OS=Homo sapiens OX=9606 GN=RFPL3 PE=1 SV=2
3	A6NLU0	1.36e-117	342	287	0.514	0.568	RFPLA_HUMAN Ret finger protein-like 4A OS=Homo sapiens OX=9606 GN=RFPL4A PE=1 SV=3
4	Q8VH31	2.29e-97	290	287	0.483	0.533	RFPLA_MOUSE Ret finger protein-like 4A OS=Mus musculus OX=10090 GN=Rfpl4a PE=1 SV=1
5	A0A1U9X8R9	6.25e-43	156	513	0.259	0.160	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
6	P14373	6.25e-43	156	513	0.259	0.160	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
7	Q62158	7.29e-43	156	513	0.259	0.160	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
8	A0A0R4IUT0	7.52e-42	154	544	0.300	0.175	A0A0R4IUT0_DANRE Bloodthirsty-related gene family, member 20 OS=Danio rerio OX=7955 GN=btr20 PE=4 SV=1
9	O00478	1.01e-41	154	584	0.293	0.159	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
10	F8W6Z2	2.73e-41	153	601	0.243	0.128	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
11	O15553	7.74e-41	153	781	0.243	0.099	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
12	P19474	2.63e-40	148	475	0.281	0.187	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
13	O00481	1.00e-39	147	513	0.240	0.148	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
14	Q8BVP1	1.37e-39	146	470	0.237	0.160	TRIML_MOUSE Probable E3 ubiquitin-protein ligase TRIML1 OS=Mus musculus OX=10090 GN=Triml1 PE=1 SV=1
15	R4GMV1	5.15e-38	139	343	0.268	0.248	R4GMV1_HUMAN Tripartite motif containing 11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=1
16	Q96F44	2.77e-37	140	468	0.262	0.177	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
17	Q3U7K7	1.12e-36	138	462	0.249	0.171	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
18	Q62191	1.15e-36	139	470	0.249	0.168	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
19	Q13410	6.04e-36	137	526	0.246	0.148	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
20	Q5NCC9	2.05e-35	135	485	0.227	0.148	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13765 PRY	3.5e-11	53.9	SPRY-associated domain
2	PF11002 RDM	3.6e-19	79.8	RFPL defining motif (RDM)
3	PF00622 SPRY	1.3e-13	62.5	SPRY domain
4	PF15227 zf-C3HC4_4	3.7e-14	63.9	zinc finger of C3HC4-type, RING
5	PF13445 zf-RING_UBOX	36	15.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482492	0.909	Putative protein RFPL3S
2	9606.ENSP00000346342	0.667	Ret finger protein like 1
3	9606.ENSP00000404100	0.631	Paired box protein Pax-6
4	9606.ENSP00000260952	0.554	Asparagine synthetase domain containing 1
5	9606.ENSP00000362792	0.550	Olfactory receptor 1N2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0048518	0.980	positive regulation of biological process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0048523	0.978	negative regulation of cellular process
GO:0080090	0.977	regulation of primary metabolic process
GO:0065009	0.974	regulation of molecular function
GO:0048522	0.967	positive regulation of cellular process
GO:0044093	0.964	positive regulation of molecular function
GO:0009893	0.957	positive regulation of metabolic process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0060255	0.907	regulation of macromolecule metabolic process
GO:0045786	0.880	negative regulation of cell cycle
GO:0045862	0.872	positive regulation of proteolysis
GO:0051336	0.865	regulation of hydrolase activity
GO:0007346	0.865	regulation of mitotic cell cycle
GO:0061136	0.859	regulation of proteasomal protein catabolic process
GO:0010948	0.854	negative regulation of cell cycle process
GO:1903052	0.843	positive regulation of proteolysis involved in protein catabolic process
GO:0051345	0.841	positive regulation of hydrolase activity
GO:0032434	0.835	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0009987	0.831	cellular process
GO:1902749	0.830	regulation of cell cycle G2/M phase transition
GO:0045930	0.826	negative regulation of mitotic cell cycle
GO:1901990	0.823	regulation of mitotic cell cycle phase transition
GO:1901988	0.823	negative regulation of cell cycle phase transition
GO:0045732	0.814	positive regulation of protein catabolic process
GO:0010942	0.811	positive regulation of cell death
GO:1902750	0.804	negative regulation of cell cycle G2/M phase transition
GO:0051782	0.801	negative regulation of cell division
GO:1901991	0.800	negative regulation of mitotic cell cycle phase transition
GO:0043068	0.796	positive regulation of programmed cell death
GO:1901800	0.786	positive regulation of proteasomal protein catabolic process
GO:2000116	0.769	regulation of cysteine-type endopeptidase activity
GO:0031325	0.762	positive regulation of cellular metabolic process
GO:0042981	0.714	regulation of apoptotic process
GO:0010389	0.711	regulation of G2/M transition of mitotic cell cycle
GO:0043280	0.709	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0032436	0.634	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043065	0.603	positive regulation of apoptotic process
GO:0008152	0.449	metabolic process
GO:0071704	0.406	organic substance metabolic process
GO:0044238	0.405	primary metabolic process
GO:0042127	0.391	regulation of cell population proliferation
GO:0006807	0.375	nitrogen compound metabolic process
GO:0050896	0.370	response to stimulus
GO:0043170	0.365	macromolecule metabolic process
GO:1901564	0.365	organonitrogen compound metabolic process
GO:0010972	0.346	negative regulation of G2/M transition of mitotic cell cycle
GO:0019538	0.316	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.707	intracellular organelle
GO:0043231	0.696	intracellular membrane-bounded organelle
GO:0005634	0.559	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]