StarFunc result for job id O75688

User Input

>input (479 residues)
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKR
NVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75688	1.000	1.000	6.980E-92	479	1.000	1.000	O75688.pdb.gz	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
2	AFDB:Q5U386	0.768	0.961	2.758E-65	382	0.660	0.827	Q5U386.pdb.gz	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
3	AFDB:A0A024R6A5	0.780	0.976	1.099E-63	382	0.608	0.762	A0A024R6A5.pdb.gz
4	PDB:1a6qA	0.745	0.981	6.296E-60	363	0.595	0.785	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
5	AFDB:Q961C5	0.742	0.945	2.644E-49	374	0.413	0.529	Q961C5.pdb.gz	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
6	AFDB:Q09172	0.573	0.736	3.602E-34	370	0.267	0.346	Q09172.pdb.gz	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
7	AFDB:P49596	0.567	0.752	1.933E-33	356	0.276	0.371	P49596.pdb.gz	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
8	AFDB:Q09173	0.572	0.658	1.882E-32	414	0.276	0.319	Q09173.pdb.gz	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1
9	AFDB:A0A1D8PRZ8	0.580	0.481	2.404E-31	583	0.271	0.223	A0A1D8PRZ8.pdb.gz	A0A1D8PRZ8_CANAL Type 2C protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTC2 PE=3 SV=1
10	AFDB:Q381U4	0.557	0.620	4.134E-31	429	0.230	0.256	Q381U4.pdb.gz	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1
11	AFDB:O81716	0.556	0.746	1.602E-30	355	0.248	0.335	O81716.pdb.gz	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
12	PDB:4oicB	0.481	0.745	7.019E-23	305	0.223	0.351	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
13	PDB:4jndA	0.492	0.572	5.819E-20	408	0.169	0.199	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
14	PDB:7kprA	0.452	0.530	7.061E-15	403	0.146	0.174	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:5nzzD	0.459	0.569	4.584E-13	379	0.117	0.148	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
16	PDB:5d2uA	0.370	0.674	8.555E-12	240	0.109	0.217	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
17	PDB:2pk0A	0.387	0.694	1.731E-11	247	0.115	0.223	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
18	PDB:6jkvA	0.376	0.732	6.708E-11	230	0.117	0.243	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.339	0.737	9.058E-8	199	0.075	0.181	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.336	0.371	1.992E-4	427	0.115	0.129	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JIR6	0.0	793	378	0.789	1.000	C9JIR6_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
2	O75688	0.0	993	479	1.000	1.000	PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens OX=9606 GN=PPM1B PE=1 SV=1
3	P20650	0.0	606	382	0.608	0.762	PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1
4	P35813	0.0	605	382	0.608	0.762	PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
5	P36993	0.0	759	390	0.745	0.915	PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1
6	P49443	0.0	604	382	0.608	0.762	PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus OX=10090 GN=Ppm1a PE=1 SV=1
7	Q5U386	0.0	660	382	0.660	0.827	Q5U386_DANRE Protein phosphatase 1A, magnesium dependent, alpha OS=Danio rerio OX=7955 GN=ppm1a PE=1 SV=1
8	Q961C5	1.26e-135	397	374	0.418	0.535	Q961C5_DROME Alphabet, isoform E OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
9	Q9VAK1	3.87e-135	396	368	0.415	0.541	Q9VAK1_DROME Alphabet, isoform A OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
10	Q8IMK7	4.73e-135	396	371	0.415	0.536	Q8IMK7_DROME Alphabet, isoform B OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
11	A0A0B4K7Q3	1.39e-126	373	332	0.380	0.548	A0A0B4K7Q3_DROME Alphabet, isoform F OS=Drosophila melanogaster OX=7227 GN=alph PE=1 SV=1
12	E9PKB5	2.54e-103	308	187	0.309	0.791	E9PKB5_HUMAN Protein phosphatase, Mg2+/Mn2+ dependent 1A (Fragment) OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
13	E9PJN3	5.49e-81	249	148	0.246	0.797	E9PJN3_HUMAN Protein phosphatase, Mg2+/Mn2+ dependent 1A (Fragment) OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1
14	Q38BA8	1.05e-63	210	293	0.257	0.420	Q38BA8_TRYB2 Protein phosphatase 2C-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2270 PE=4 SV=1
15	P49596	2.48e-63	211	356	0.255	0.343	PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans OX=6239 GN=ppm-2 PE=3 SV=2
16	O81716	1.03e-61	207	355	0.246	0.332	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
17	Q9SZ53	2.83e-60	203	357	0.255	0.342	P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana OX=3702 GN=At4g31860 PE=2 SV=1
18	Q09172	4.70e-59	200	370	0.248	0.322	PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc2 PE=3 SV=1
19	Q09173	4.84e-58	199	414	0.236	0.273	PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc3 PE=3 SV=1
20	Q381U4	3.26e-56	194	429	0.238	0.266	Q381U4_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6540 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11938 DUF3456	5.3e+02	12.5	TLR4 regulator and MIR-interacting MSAP
2	PF00481 PP2C	3.9e-78	274.2	Protein phosphatase 2C
3	PF13672 PP2C_2	4.3	18.4	Protein phosphatase 2C
4	PF07830 PP2C_C	8.3e-29	111.2	Protein serine/threonine phosphatase 2C, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282412

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369217	0.935	E3 ubiquitin-protein ligase ARIH1
2	9606.ENSP00000287156	0.921	Ubiquitin/ISG15-conjugating enzyme E2 L6
3	9606.ENSP00000368699	0.918	Ubiquitin-like protein ISG15
4	9606.ENSP00000264350	0.912	E3 ISG15--protein ligase HERC5
5	9606.ENSP00000386543	0.912	Prolyl endopeptidase-like
6	9606.ENSP00000367755	0.910	Calmodulin-lysine N-methyltransferase
7	9606.ENSP00000323889	0.908	E3 ubiquitin/ISG15 ligase TRIM25
8	9606.ENSP00000260649	0.906	Neutral and basic amino acid transport protein rBAT
9	9606.ENSP00000358335	0.903	Mitogen-activated protein kinase kinase kinase 7
10	9606.ENSP00000247843	0.849	YEATS domain-containing protein 4
11	9606.ENSP00000359424	0.793	Inhibitor of nuclear factor kappa-B kinase subunit alpha
12	9606.ENSP00000361423	0.735	Tyrosine-protein kinase ABL1
13	9606.ENSP00000327255	0.734	Protein phosphatase 1A
14	9606.ENSP00000345773	0.713	BEN domain containing 7
15	9606.ENSP00000221138	0.703	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
16	9606.ENSP00000354346	0.697	Matrin-3
17	9606.ENSP00000307214	0.693	tRNA wybutosine-synthesizing protein 4
18	9606.ENSP00000430684	0.684	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000269919	0.681	Pyroglutamyl-peptidase 1
20	9606.ENSP00000469413	0.681	Serine/threonine-protein kinase PAK 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0036211	0.995	protein modification process
GO:0065007	0.986	biological regulation
GO:0006796	0.984	phosphate-containing compound metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0006470	0.974	protein dephosphorylation
GO:0048583	0.939	regulation of response to stimulus
GO:0009966	0.867	regulation of signal transduction
GO:0048523	0.853	negative regulation of cellular process
GO:0019222	0.686	regulation of metabolic process
GO:0060255	0.622	regulation of macromolecule metabolic process
GO:0050896	0.455	response to stimulus
GO:0010468	0.416	regulation of gene expression
GO:0048518	0.388	positive regulation of biological process
GO:1902531	0.383	regulation of intracellular signal transduction
GO:0080090	0.338	regulation of primary metabolic process
GO:0080134	0.322	regulation of response to stress
GO:0051171	0.316	regulation of nitrogen compound metabolic process
GO:0048522	0.316	positive regulation of cellular process
GO:0031323	0.311	regulation of cellular metabolic process
GO:0009968	0.311	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0016020	0.872	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]