StarFunc result for job id O75691

User Input

>input (1400 residues)
MKTKPVSHKTENTYRFLTFAERLGNVNIDIIHRIDRTASYEEEVETYFFEGLLKWRELNL
TEHFGKFYKEVIDKCQSFNQLVYHQNEIVQSLKTHLQVKNSFAYQPLLDLVVQLARDLQM
DFYPHFPEFFLTITSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSSIYSMYSTLLAH
KKLHIRNFAAESFTFLMRKVSDKNALFNLMFLDLDKHPEKVEGVGQLLFEMCKGVRNMFH
SCTGQAVKLILRKLGPVTETETQLPWMLIGETLKNMVKSTVSYISKEHFGTFFECLQESL
LDLHTKVTKTNCCESSEQIKRLLETYLILVKHGSGTKIPTPADVCKVLSQTLQVASLSTS
CWETLLDVISALILGENVSLPETLIKETIEKIFESRFEKRLIFSFSEVMFAMKQFEQLFL
PSFLSYIVNCFLIDDAVVKDEALAILAKLILNKAAPPTAGSMAIEKYPLVFSPQMVGFYI
KQKKTRSKGRNEQFPVLDHLLSIIKLPPNKDTTYLSQSWAALVVLPHIRPLEKEKVIPLV
TGFIEALFMTVDKGSFGKGNLFVLCQAVNTLLSLEESSELLHLVPVERVKNLVLTFPLEP
SVLLLTDLYYQRLALCGCKGPLSQEALMELFPKLQANISTGVSKIRLLTIRILNHFDVQL
PESMEDDGLSERQSVFAILRQAELVPATVNDYREKLLHLRKLRHDVVQTAVPDGPLQEVP
LRYLLGMLYINFSALWDPVIELISSHAHEMENKQFWKVYYEHLEKAATHAEKELQNDMTD
EKSVGDESWEQTQEGDVGALYHEQLALKTDCQERLDHTNFRFLLWRALTKFPERVEPRSR
ELSPLFLRFINNEYYPADLQVAPTQDLRRKGKGMVAEEIEEEPAAGDDEELEEEAVPQDE
SSQKKKTRRAAAKQLIAHLQVFSKFSNPRALYLESKLYELYLQLLLHQDQMVQKITLDCI
MTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRM
KNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEIQIFLDLLFEPVRHFKNGECHSAVIQAV
EDLDLSKVLPLGRQHGILNSLEIVLKNISHLISAYLPKILQILLCMTATVSHILDQREKI
QLRFINPLKNLRRLGIKMVTDIFLDWESYQFRTEEIDAVFHGAVWPQISRLGSESQYSPT
PLLKLISIWSRNARYFPLLAKQKPGHPECDILTNVFAILSAKNLSDATASIVMDIVDDLL
NLPDFEPTETVLNLLVTGCVYPGIAENIGESITIGGRLILPHVPAILQYLSKTTISAEKV
KKKKNRAQVSKELGILSKISKFMKDKEQSSVLITLLLPFLHRGNIAEDTEVDILVTVQNL
LKHCVDPTSFLKPIAKLFSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq8SP	0.574	0.426	0.000	1993	0.930	0.653	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	PDB:7mqaSP	0.573	0.351	0.000	2485	0.922	0.520	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:O60055	0.645	0.389	2.173E-30	2493	0.196	0.110	O60055.pdb.gz	UTP20_SCHPO U3 small nucleolar RNA-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp20 PE=3 SV=1
4	AFDB:P35194	0.617	0.371	2.456E-29	2493	0.181	0.102	P35194.pdb.gz	UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP20 PE=1 SV=3
5	PDB:7ajuUT	0.467	0.310	1.392E-26	2313	0.177	0.107	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
6	PDB:7sukSP	0.446	0.306	5.665E-24	2234	0.186	0.117	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
7	PDB:6lqsRP	0.379	0.268	2.284E-11	2180	0.117	0.075	6lqsRP.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
8	AFDB:Q94FN2	0.116	0.086	1.951E-9	1978	0.145	0.103	Q94FN2.pdb.gz	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
9	AFDB:Q8VI75	0.192	0.229	3.546E-9	1082	0.131	0.169	Q8VI75.pdb.gz	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
10	AFDB:Q9FR53	0.197	0.125	3.546E-9	2481	0.136	0.077	Q9FR53.pdb.gz	TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana OX=3702 GN=TOR PE=1 SV=1
11	AFDB:A2AGT5	0.145	0.109	6.444E-9	2032	0.126	0.087	A2AGT5.pdb.gz	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
12	AFDB:Q10105	0.151	0.095	1.348E-8	2670	0.150	0.079	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
13	AFDB:E9PVA8	0.148	0.100	1.664E-8	2671	0.126	0.066	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
14	AFDB:Q93VS8	0.232	0.277	1.724E-8	1116	0.106	0.134	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
15	PDB:7d4iRP	0.235	0.170	4.067E-8	2084	0.158	0.106	7d4iRP.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	AFDB:Q9P3A8	0.236	0.262	4.776E-8	1220	0.105	0.120	Q9P3A8.pdb.gz	CAND1_SCHPO Cullin-associated NEDD8-dissociated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=knd1 PE=3 SV=1
17	PDB:7wttK	0.210	0.263	2.357E-7	1022	0.094	0.128	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:6xu2A	0.157	0.184	5.477E-7	1091	0.120	0.154	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:7mopA	0.187	0.133	1.273E-6	2445	0.122	0.070	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
20	PDB:3w3uA	0.188	0.232	1.415E-6	1030	0.109	0.149	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75691	0.0	2888	2785	1.000	0.503	UTP20_HUMAN Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3
2	O60055	1.12e-34	147	2493	0.060	0.034	UTP20_SCHPO U3 small nucleolar RNA-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp20 PE=3 SV=1
3	P35194	1.47e-28	127	2493	0.071	0.040	UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP20 PE=1 SV=3
4	F4JR52	1.15e-25	118	2619	0.077	0.041	F4JR52_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30990 PE=1 SV=2
5	Q38BM0	0.63	37.4	3901	0.026	0.009	Q38BM0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3570 PE=4 SV=1
6	Q9SGS4	2.8	34.3	302	0.018	0.083	CDSP_ARATH Thioredoxin-like protein CDSP32, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CDSP32 PE=1 SV=1
7	Q5SRE5	3.3	34.7	1749	0.017	0.014	NU188_HUMAN Nucleoporin NUP188 OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1
8	B6HLU1	6.9	33.9	3746	0.026	0.010	ACVA_PENRW N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=acvA PE=1 SV=2
9	P19787	6.9	33.9	3746	0.026	0.010	ACVA_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum OX=5076 GN=acvA PE=1 SV=1
10	Q9Z2R7	8.3	33.5	1104	0.018	0.023	Q9Z2R7_RAT Replication factor C subunit 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
11	P0A756	9.0	32.3	184	0.014	0.109	KEFG_ECOLI Glutathione-regulated potassium-efflux system ancillary protein KefG OS=Escherichia coli (strain K12) OX=83333 GN=kefG PE=3 SV=1
12	Q586C7	9.4	33.1	1081	0.039	0.050	Q586C7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.280 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07539 DRIM	1.6e-134	461.2	Down-regulated in metastasis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297990	0.999	Nucleolar protein 6
2	9606.ENSP00000355541	0.999	HEAT repeat-containing protein 1
3	9606.ENSP00000358812	0.999	Protein RRP5 homolog
4	9606.ENSP00000363642	0.999	Ribosome biogenesis protein BMS1 homolog
5	9606.ENSP00000405068	0.999	Nucleolar protein 14
6	9606.ENSP00000264279	0.998	Nucleolar protein 58
7	9606.ENSP00000297579	0.998	DDB1- and CUL4-associated factor 13
8	9606.ENSP00000314193	0.998	WD repeat-containing protein 75
9	9606.ENSP00000327179	0.998	U3 small nucleolar RNA-associated protein 4 homolog
10	9606.ENSP00000423067	0.998	WD repeat-containing protein 36
11	9606.ENSP00000454836	0.998	Transducin beta-like protein 3
12	9606.ENSP00000229214	0.997	KRR1 small subunit processome component homolog
13	9606.ENSP00000257829	0.997	RNA cytidine acetyltransferase
14	9606.ENSP00000308179	0.997	WD repeat-containing protein 3
15	9606.ENSP00000328854	0.997	Nucleolar complex protein 4 homolog
16	9606.ENSP00000344393	0.995	rRNA-processing protein FCF1 homolog
17	9606.ENSP00000371169	0.995	RNA 3'-terminal phosphate cyclase-like protein
18	9606.ENSP00000232888	0.994	U3 small nucleolar RNA-interacting protein 2
19	9606.ENSP00000363746	0.994	WD repeat-containing protein 46
20	9606.ENSP00000370589	0.993	Nucleolar protein 56

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006364	0.939	rRNA processing
GO:0050789	0.926	regulation of biological process
GO:0008285	0.889	negative regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0016020	0.999	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005737	0.749	cytoplasm
GO:0012505	0.377	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]