StarFunc result for job id O75694

User Input

>input (1391 residues)
MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVI
QVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGS
PVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIAS
LINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRES
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDL
LWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPR
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKP
LHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNF
KSLQAKLERLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5jD4	0.869	0.918	0.000	1312	0.943	1.000	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:F1Q953	0.880	0.880	0.000	1391	0.737	0.737	F1Q953.pdb.gz
3	AFDB:O75694	1.000	1.000	0.000	1391	1.000	1.000	O75694.pdb.gz	NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1
4	PDB:5a9qA	0.579	0.707	2.737E-87	1097	0.766	0.972	5a9qA.pdb.gz
5	AFDB:Q9V463	0.746	0.759	8.970E-83	1365	0.324	0.330	Q9V463.pdb.gz	NU154_DROME Nuclear pore complex protein Nup154 OS=Drosophila melanogaster OX=7227 GN=Nup154 PE=1 SV=1
6	PDB:7r1yA	0.503	0.952	5.186E-77	723	0.517	0.994	7r1yA.pdb.gz
7	AFDB:Q95Y15	0.601	0.619	4.744E-67	1340	0.257	0.266	Q95Y15.pdb.gz	Q95Y15_CAEEL Nucleoporin_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-8 PE=1 SV=5
8	AFDB:Q9URX8	0.524	0.551	2.587E-61	1315	0.234	0.248	Q9URX8.pdb.gz	NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC890.06 PE=3 SV=3
9	PDB:7eyqA	0.477	0.752	1.359E-60	833	0.593	0.990	7eyqA.pdb.gz
10	AFDB:F4HXV6	0.758	0.723	7.935E-60	1464	0.249	0.236	F4HXV6.pdb.gz	NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana OX=3702 GN=NUP155 PE=1 SV=1
11	AFDB:G0S7B6	0.713	0.702	6.196E-57	1416	0.229	0.225	G0S7B6.pdb.gz	NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP170 PE=1 SV=1
12	AFDB:P38181	0.616	0.576	2.234E-52	1502	0.200	0.185	P38181.pdb.gz	NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP170 PE=1 SV=1
13	AFDB:Q54F20	0.680	0.608	7.918E-52	1575	0.198	0.175	Q54F20.pdb.gz	Q54F20_DICDI Nucleoporin 155 OS=Dictyostelium discoideum OX=44689 GN=nup155 PE=4 SV=1
14	PDB:7wooC	0.605	0.630	1.920E-49	1325	0.186	0.195	7wooC.pdb.gz
15	AFDB:P40064	0.603	0.603	6.183E-49	1391	0.185	0.185	P40064.pdb.gz	NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP157 PE=1 SV=1
16	PDB:7wooD	0.617	0.614	2.464E-43	1398	0.201	0.200	7wooD.pdb.gz
17	PDB:7n9f1	0.389	0.465	2.994E-24	1113	0.175	0.218	7n9f1.pdb.gz
18	PDB:7n850	0.462	0.552	2.437E-20	1102	0.165	0.209	7n850.pdb.gz
19	PDB:7r5jK0	0.186	0.227	1.128E-9	1086	0.093	0.120	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:7r5jR0	0.193	0.192	1.309E-9	1399	0.115	0.114	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PF10	0.0	2628	1327	0.926	0.971	E9PF10_HUMAN Nucleoporin 155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1
2	O75694	0.0	2879	1391	1.000	1.000	NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1
3	P37199	0.0	2713	1390	0.937	0.938	NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus OX=10116 GN=Nup155 PE=1 SV=1
4	Q7ZW07	0.0	2118	1391	0.735	0.735	Q7ZW07_DANRE Nuclear pore complex protein Nup155 OS=Danio rerio OX=7955 GN=zgc:55435 PE=1 SV=1
5	Q99P88	0.0	2719	1391	0.949	0.949	NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus OX=10090 GN=Nup155 PE=1 SV=1
6	Q9V463	0.0	746	1365	0.331	0.337	NU154_DROME Nuclear pore complex protein Nup154 OS=Drosophila melanogaster OX=7227 GN=Nup154 PE=1 SV=1
7	Q95Y15	5.89e-128	431	1340	0.251	0.260	Q95Y15_CAEEL Nucleoporin_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-8 PE=1 SV=5
8	Q9URX8	1.86e-92	329	1315	0.235	0.249	NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC890.06 PE=3 SV=3
9	C8V1X8	1.27e-85	309	1346	0.228	0.236	C8V1X8_EMENI Nuclear pore complex protein An-Nup170 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06738 PE=3 SV=1
10	Q95Y13	1.88e-51	189	411	0.088	0.297	Q95Y13_CAEEL Nucleoporin Nup133/Nup155-like N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-8 PE=1 SV=1
11	G0S7B6	2.07e-44	179	1416	0.111	0.109	NU170_CHATD Nucleoporin NUP170 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP170 PE=1 SV=1
12	P40064	3.25e-43	175	1391	0.197	0.197	NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP157 PE=1 SV=1
13	F4HXV6	8.09e-42	171	1464	0.152	0.144	NU155_ARATH Nuclear pore complex protein NUP155 OS=Arabidopsis thaliana OX=3702 GN=NUP155 PE=1 SV=1
14	P38181	7.12e-31	135	1502	0.077	0.071	NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP170 PE=1 SV=1
15	Q54F20	9.96e-31	134	1575	0.051	0.045	Q54F20_DICDI Nucleoporin 155 OS=Dictyostelium discoideum OX=44689 GN=nup155 PE=4 SV=1
16	Q38AE7	1.26e-30	134	1325	0.096	0.100	Q38AE7_TRYB2 Nuclear pore complex protein (NUP155), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2350 PE=3 SV=1
17	Q8EJW2	0.35	37.4	375	0.028	0.104	PRPC_SHEON 2-methylcitrate synthase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=prpC PE=3 SV=1
18	Q9SHG7	0.59	35.4	154	0.012	0.104	Q9SHG7_ARATH At1g17080/F6I1.24 OS=Arabidopsis thaliana OX=3702 GN=At1g17080 PE=1 SV=1
19	A0A0G2JWX2	3.3	34.7	3121	0.040	0.018	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1
20	F1M614	3.3	34.7	3117	0.040	0.018	F1M614_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14585 CagY_I	5.5e+02	12.1	CagY type 1 repeat
2	PF09959 DUF2193	5.7e+02	10.3	Uncharacterized protein conserved in archaea (DUF2193)
3	PF03177 Nucleoporin_C	8.2e-16	69.6	Non-repetitive/WGA-negative nucleoporin C-terminal
4	PF08801 Nucleoporin_N	3e-105	364.1	Nup133 N terminal like
5	PF01806 Paramyxo_P	1.8e+02	12.9	Paramyxovirinae P phosphoprotein C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231498

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285968	0.999	Nuclear pore complex protein Nup205
2	9606.ENSP00000295119	0.999	Nucleoporin NUP53
3	9606.ENSP00000308622	0.999	Nucleoporin GLE1
4	9606.ENSP00000310668	0.999	Nuclear pore complex protein Nup93
5	9606.ENSP00000316032	0.999	Nuclear pore complex protein Nup98-Nup96
6	9606.ENSP00000229179	0.998	Nuclear pore complex protein Nup107
7	9606.ENSP00000261396	0.998	Nuclear pore complex protein Nup133
8	9606.ENSP00000264606	0.998	Histone deacetylase 4
9	9606.ENSP00000361658	0.998	Nucleoporin NUP188 homolog
10	9606.ENSP00000245544	0.996	Nuclear pore complex protein Nup85
11	9606.ENSP00000382779	0.996	Nucleoporin SEH1
12	9606.ENSP00000367721	0.995	Nuclear pore complex protein Nup160
13	9606.ENSP00000444029	0.995	Nuclear pore complex protein Nup153
14	9606.ENSP00000342262	0.993	Nucleoporin Nup43
15	9606.ENSP00000471191	0.992	Nuclear pore glycoprotein p62
16	9606.ENSP00000264883	0.989	Nucleoporin p54
17	9606.ENSP00000373312	0.988	Protein SEC13 homolog
18	9606.ENSP00000352400	0.982	Nuclear pore complex protein Nup214
19	9606.ENSP00000484669	0.981	Cleavage and polyadenylation specificity factor subunit 1
20	9606.ENSP00000448054	0.978	Nucleoporin Nup37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.958	cellular component organization
GO:0065007	0.907	biological regulation
GO:0050789	0.854	regulation of biological process
GO:0006996	0.836	organelle organization
GO:0071704	0.749	organic substance metabolic process
GO:0051179	0.726	localization
GO:0051234	0.695	establishment of localization
GO:0006810	0.693	transport
GO:0051641	0.691	cellular localization
GO:0043170	0.670	macromolecule metabolic process
GO:0044237	0.571	cellular metabolic process
GO:0051649	0.565	establishment of localization in cell
GO:0044238	0.561	primary metabolic process
GO:0006807	0.553	nitrogen compound metabolic process
GO:0033036	0.488	macromolecule localization
GO:0006725	0.483	cellular aromatic compound metabolic process
GO:1901360	0.475	organic cyclic compound metabolic process
GO:0046907	0.472	intracellular transport
GO:0006139	0.472	nucleobase-containing compound metabolic process
GO:0050794	0.430	regulation of cellular process
GO:0090304	0.424	nucleic acid metabolic process
GO:0019222	0.421	regulation of metabolic process
GO:0048519	0.404	negative regulation of biological process
GO:0060255	0.401	regulation of macromolecule metabolic process
GO:0010467	0.328	gene expression
GO:0010256	0.315	endomembrane system organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	1.000	nuclear envelope
GO:0016020	0.977	membrane
GO:0005737	0.967	cytoplasm
GO:0032991	0.957	protein-containing complex
GO:0031981	0.949	nuclear lumen
GO:0005829	0.901	cytosol
GO:0031090	0.861	organelle membrane
GO:0031965	0.657	nuclear membrane
GO:0005654	0.583	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]