StarFunc result for job id O75717

User Input

>input (1129 residues)
MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSC
ALKSGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKI
VDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKC
NDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRESWSHQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFSKGIINDDEDD
EDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPLVTSQRPF
YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATH
LSNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICL
GQGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLG
VQLLELGKKKKQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP
ICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIAT
EKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLALSCKLEREFR
CVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQVEEEEEEEDFRKK
LNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKS
GAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPI
IKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKT
GFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEA
KKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O13046	0.514	0.514	0.000	1127	0.655	0.656	O13046.pdb.gz	WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis OX=8355 GN=wdhd1 PE=1 SV=1
2	AFDB:O75717	1.000	1.000	0.000	1129	1.000	1.000	O75717.pdb.gz	WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1
3	AFDB:P59328	0.800	0.808	0.000	1117	0.827	0.836	P59328.pdb.gz	WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Wdhd1 PE=1 SV=2
4	AFDB:Q494K2	0.381	0.458	3.013E-76	895	0.238	0.301	Q494K2.pdb.gz	Q494K2_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=Ctf4 PE=1 SV=1
5	PDB:7ploI	0.353	0.877	1.487E-68	451	0.399	0.998	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
6	AFDB:C8VF02	0.341	0.455	2.757E-58	836	0.159	0.214	C8VF02.pdb.gz	C8VF02_EMENI SepB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10635 PE=4 SV=1
7	PDB:6ptjF	0.313	0.773	3.345E-23	431	0.077	0.202	6ptjF.pdb.gz
8	PDB:7mq8LR	0.234	0.330	7.442E-20	773	0.092	0.135	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:2h9lA	0.241	0.799	1.843E-19	321	0.061	0.215	2h9lA.pdb.gz
10	PDB:1nr0A	0.242	0.429	2.038E-19	610	0.077	0.143	1nr0A.pdb.gz
11	PDB:3sfzA	0.241	0.240	1.074E-18	1133	0.082	0.082	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
12	PDB:5nzrC	0.227	0.300	2.943E-18	843	0.084	0.113	5nzrC.pdb.gz
13	PDB:5mzhB	0.231	0.576	3.981E-18	415	0.055	0.149	5mzhB.pdb.gz
14	PDB:7mq8LN	0.218	0.356	7.663E-18	671	0.064	0.107	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5juyB	0.243	0.224	1.037E-17	1234	0.092	0.084	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
16	AFDB:F1LRR4	0.237	0.178	5.729E-15	1551	0.097	0.070	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
17	AFDB:Q9VC96	0.222	0.117	6.663E-15	2232	0.168	0.085	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
18	AFDB:Q9C0J8	0.234	0.199	2.348E-14	1336	0.126	0.106	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
19	AFDB:O60336	0.229	0.173	2.469E-14	1514	0.134	0.100	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
20	AFDB:F4KIH8	0.224	0.186	4.001E-12	1377	0.103	0.084	F4KIH8.pdb.gz	F4KIH8_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TWD40-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O13046	0.0	1495	1127	0.660	0.661	WDHD1_XENLA WD repeat and HMG-box DNA-binding protein 1 OS=Xenopus laevis OX=8355 GN=wdhd1 PE=1 SV=1
2	O75717	0.0	2356	1129	1.000	1.000	WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1
3	P59328	0.0	1884	1117	0.833	0.842	WDHD1_MOUSE WD repeat and HMG-box DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Wdhd1 PE=1 SV=2
4	Q494K2	1.82e-114	379	895	0.225	0.284	Q494K2_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=Ctf4 PE=1 SV=1
5	Q2XY08	3.61e-114	377	878	0.224	0.288	Q2XY08_DROME WD repeat-containing protein 55 homolog (Fragment) OS=Drosophila melanogaster OX=7227 GN=Ctf4 PE=4 SV=1
6	F4JF14	1.04e-80	286	953	0.192	0.228	ENOL1_ARATH Protein ENHANCER OF LHP1 1 OS=Arabidopsis thaliana OX=3702 GN=EOL1 PE=1 SV=1
7	Q95R77	8.70e-68	240	542	0.118	0.245	Q95R77_DROME SD03057p OS=Drosophila melanogaster OX=7227 GN=Ctf4 PE=2 SV=1
8	Q9C107	1.17e-60	225	815	0.194	0.269	MCL1_SCHPO Minichromosome loss protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcl1 PE=1 SV=1
9	C8VF02	3.97e-60	224	836	0.169	0.228	C8VF02_EMENI SepB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10635 PE=4 SV=1
10	Q01454	2.27e-18	93.6	927	0.140	0.170	CTF4_YEAST DNA polymerase alpha-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTF4 PE=1 SV=2
11	Q4GYD0	8.69e-14	79.0	1484	0.094	0.071	Q4GYD0_TRYB2 Minichromosome loss protein Mcl1 middle region domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4480 PE=4 SV=1
12	Q676U5	6.67e-12	72.0	607	0.066	0.124	A16L1_HUMAN Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2
13	Q7ZTX2	7.87e-12	70.5	334	0.063	0.213	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
14	P61964	8.08e-12	70.1	334	0.061	0.207	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
15	P61965	8.08e-12	70.1	334	0.061	0.207	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
16	Q498M4	8.08e-12	70.1	334	0.061	0.207	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
17	Q8C0J2	2.64e-11	70.1	607	0.051	0.096	A16L1_MOUSE Autophagy-related protein 16-1 OS=Mus musculus OX=10090 GN=Atg16l1 PE=1 SV=1
18	Q9V3J8	3.58e-11	68.6	361	0.061	0.191	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
19	O48847	1.93e-10	67.8	787	0.043	0.062	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
20	Q5U3Q5	2.22e-10	67.4	897	0.047	0.059	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.6e-08	44.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.0057	28.1	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	30	15.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF00505 HMG_box	0.16	23.7	HMG (high mobility group) box
5	PF12341 Mcl1_mid	1.5e-92	321.7	Minichromosome loss protein, Mcl1, middle region
6	PF20426 NBCH_WD40	94	13.3	Neurobeachin beta propeller domain
7	PF00400 WD40	4e-16	70.3	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253462	0.999	DNA replication complex GINS protein PSF2
2	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
3	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
4	9606.ENSP00000276533	0.999	DNA replication complex GINS protein SLD5
5	9606.ENSP00000307288	0.999	DNA replication licensing factor MCM7
6	9606.ENSP00000351185	0.999	DNA replication ATP-dependent helicase/nuclease DNA2
7	9606.ENSP00000405726	0.999	Cell division control protein 45 homolog
8	9606.ENSP00000418268	0.999	Protein MCM10 homolog
9	9606.ENSP00000216122	0.998	DNA replication licensing factor MCM5
10	9606.ENSP00000262460	0.998	DNA replication complex GINS protein PSF1
11	9606.ENSP00000264156	0.998	DNA replication licensing factor MCM6
12	9606.ENSP00000368349	0.998	DNA polymerase alpha catalytic subunit
13	9606.ENSP00000480987	0.998	DNA replication licensing factor MCM3
14	9606.ENSP00000261881	0.996	TIMELESS-interacting protein
15	9606.ENSP00000401018	0.996	GINS complex subunit 3
16	9606.ENSP00000450607	0.996	Protein timeless homolog
17	9606.ENSP00000262315	0.992	Chromosome transmission fidelity protein 18 homolog
18	9606.ENSP00000322180	0.985	Sister chromatid cohesion protein DCC1
19	9606.ENSP00000314505	0.978	DNA helicase MCM9
20	9606.ENSP00000209728	0.977	Cell division control protein 6 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.998	DNA binding
GO:0003723	0.728	RNA binding
GO:0019899	0.634	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0050789	0.996	regulation of biological process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.967	macromolecule metabolic process
GO:0046483	0.965	heterocycle metabolic process
GO:0071840	0.959	cellular component organization or biogenesis
GO:1901360	0.956	organic cyclic compound metabolic process
GO:0033044	0.956	regulation of chromosome organization
GO:0016043	0.943	cellular component organization
GO:0090304	0.937	nucleic acid metabolic process
GO:0051171	0.868	regulation of nitrogen compound metabolic process
GO:0048519	0.821	negative regulation of biological process
GO:0080090	0.790	regulation of primary metabolic process
GO:0006325	0.702	chromatin organization
GO:0010468	0.647	regulation of gene expression
GO:0031323	0.618	regulation of cellular metabolic process
GO:0016070	0.617	RNA metabolic process
GO:0044260	0.579	cellular macromolecule metabolic process
GO:0006338	0.488	chromatin remodeling
GO:0048518	0.428	positive regulation of biological process
GO:0009892	0.412	negative regulation of metabolic process
GO:0048522	0.389	positive regulation of cellular process
GO:0050896	0.387	response to stimulus
GO:0006259	0.359	DNA metabolic process
GO:0019219	0.344	regulation of nucleobase-containing compound metabolic process
GO:0022402	0.328	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0032991	0.954	protein-containing complex
GO:0005694	0.803	chromosome
GO:0098687	0.584	chromosomal region
GO:0005829	0.493	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]