StarFunc result for job id O75718

User Input

>input (401 residues)
MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHW
AESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLK
RCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEM
MKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAF
YECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHY
LQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQ
FFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75718	1.000	1.000	2.166E-53	401	1.000	1.000	O75718.pdb.gz	CRTAP_HUMAN Cartilage-associated protein OS=Homo sapiens OX=9606 GN=CRTAP PE=1 SV=1
2	AFDB:Q9CYD3	0.926	0.928	8.323E-47	400	0.885	0.887	Q9CYD3.pdb.gz	CRTAP_MOUSE Cartilage-associated protein OS=Mus musculus OX=10090 GN=Crtap PE=1 SV=3
3	AFDB:Q64375	0.851	0.774	2.033E-30	443	0.529	0.479	Q64375.pdb.gz	SC65_RAT Endoplasmic reticulum protein SC65 OS=Rattus norvegicus OX=10116 GN=P3h4 PE=2 SV=3
4	AFDB:Q90830	0.592	0.868	5.654E-25	271	0.499	0.738	Q90830.pdb.gz	CRTAP_CHICK Cartilage-associated protein OS=Gallus gallus OX=9031 GN=CRTAP PE=1 SV=1
5	AFDB:Q3V1T4	0.698	0.398	3.096E-19	739	0.354	0.192	Q3V1T4.pdb.gz	P3H1_MOUSE Prolyl 3-hydroxylase 1 OS=Mus musculus OX=10090 GN=P3h1 PE=1 SV=2
6	AFDB:Q32P28	0.704	0.407	8.201E-19	736	0.347	0.189	Q32P28.pdb.gz	P3H1_HUMAN Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2
7	AFDB:Q6JHU8	0.714	0.415	4.463E-18	725	0.302	0.167	Q6JHU8.pdb.gz	P3H1_CHICK Prolyl 3-hydroxylase 1 OS=Gallus gallus OX=9031 GN=P3H1 PE=1 SV=1
8	AFDB:Q8IVL5	0.722	0.428	1.086E-17	708	0.284	0.161	Q8IVL5.pdb.gz	P3H2_HUMAN Prolyl 3-hydroxylase 2 OS=Homo sapiens OX=9606 GN=P3H2 PE=1 SV=1
9	AFDB:Q8CG70	0.740	0.425	9.025E-17	732	0.264	0.145	Q8CG70.pdb.gz	P3H3_MOUSE Prolyl 3-hydroxylase 3 OS=Mus musculus OX=10090 GN=P3h3 PE=1 SV=1
10	AFDB:Q8IVL6	0.745	0.429	1.214E-16	736	0.262	0.143	Q8IVL6.pdb.gz	P3H3_HUMAN Prolyl 3-hydroxylase 3 OS=Homo sapiens OX=9606 GN=P3H3 PE=1 SV=1
11	PDB:7kw7E	0.155	0.179	6.366E-3	327	0.115	0.141	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
12	PDB:7dhgC	0.138	0.122	2.803E-2	470	0.112	0.096	7dhgC.pdb.gz
13	PDB:6tedQ	0.172	0.091	3.464E-2	890	0.142	0.064	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	PDB:7qe7U	0.157	0.130	4.861E-2	540	0.145	0.107	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:8a3tJ	0.181	0.157	5.071E-2	509	0.105	0.083	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:5dseA	0.155	0.127	5.519E-2	537	0.120	0.089	5dseA.pdb.gz
17	PDB:5udkA	0.178	0.162	7.424E-2	461	0.117	0.102	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
18	PDB:7qe7Y	0.144	0.125	9.175E-2	502	0.115	0.092	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:6yj6A	0.136	0.080	1.462E-1	819	0.102	0.050	6yj6A.pdb.gz
20	PDB:7qe7K	0.184	0.153	1.462E-1	531	0.095	0.072	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75718	0.0	832	401	1.000	1.000	CRTAP_HUMAN Cartilage-associated protein OS=Homo sapiens OX=9606 GN=CRTAP PE=1 SV=1
2	Q9CYD3	0.0	726	400	0.883	0.885	CRTAP_MOUSE Cartilage-associated protein OS=Mus musculus OX=10090 GN=Crtap PE=1 SV=3
3	Q90830	2.72e-147	420	271	0.494	0.731	CRTAP_CHICK Cartilage-associated protein OS=Gallus gallus OX=9031 GN=CRTAP PE=1 SV=1
4	Q8K2B0	2.60e-141	411	443	0.529	0.479	SC65_MOUSE Endoplasmic reticulum protein SC65 OS=Mus musculus OX=10090 GN=P3h4 PE=1 SV=1
5	Q64375	1.98e-140	409	443	0.519	0.470	SC65_RAT Endoplasmic reticulum protein SC65 OS=Rattus norvegicus OX=10116 GN=P3h4 PE=2 SV=3
6	Q92791	2.88e-140	409	437	0.511	0.469	SC65_HUMAN Endoplasmic reticulum protein SC65 OS=Homo sapiens OX=9606 GN=P3H4 PE=1 SV=1
7	Q32P28	6.56e-57	200	736	0.299	0.163	P3H1_HUMAN Prolyl 3-hydroxylase 1 OS=Homo sapiens OX=9606 GN=P3H1 PE=1 SV=2
8	Q9R1J8	2.33e-52	188	728	0.294	0.162	P3H1_RAT Prolyl 3-hydroxylase 1 OS=Rattus norvegicus OX=10116 GN=P3h1 PE=1 SV=1
9	Q3V1T4	1.67e-51	186	739	0.292	0.158	P3H1_MOUSE Prolyl 3-hydroxylase 1 OS=Mus musculus OX=10090 GN=P3h1 PE=1 SV=2
10	Q4KLM6	8.62e-49	177	703	0.297	0.169	P3H2_RAT Prolyl 3-hydroxylase 2 OS=Rattus norvegicus OX=10116 GN=P3h2 PE=1 SV=1
11	Q8CG71	4.06e-48	176	703	0.292	0.166	P3H2_MOUSE Prolyl 3-hydroxylase 2 OS=Mus musculus OX=10090 GN=P3h2 PE=1 SV=1
12	Q8IVL5	1.42e-45	169	708	0.299	0.169	P3H2_HUMAN Prolyl 3-hydroxylase 2 OS=Homo sapiens OX=9606 GN=P3H2 PE=1 SV=1
13	Q6JHU8	1.38e-44	166	725	0.304	0.168	P3H1_CHICK Prolyl 3-hydroxylase 1 OS=Gallus gallus OX=9031 GN=P3H1 PE=1 SV=1
14	Q8CG70	2.04e-27	116	732	0.249	0.137	P3H3_MOUSE Prolyl 3-hydroxylase 3 OS=Mus musculus OX=10090 GN=P3h3 PE=1 SV=1
15	Q8IVL6	5.96e-21	97.4	736	0.232	0.126	P3H3_HUMAN Prolyl 3-hydroxylase 3 OS=Homo sapiens OX=9606 GN=P3H3 PE=1 SV=1
16	C9J313	3.50e-14	71.2	137	0.107	0.314	C9J313_HUMAN Prolyl 3-hydroxylase 2 (Fragment) OS=Homo sapiens OX=9606 GN=P3H2 PE=1 SV=1
17	C9JSL4	1.75e-12	66.2	134	0.102	0.306	C9JSL4_HUMAN Prolyl 3-hydroxylase 2 (Fragment) OS=Homo sapiens OX=9606 GN=P3H2 PE=1 SV=1
18	Q7Z4N8	0.010	40.4	544	0.055	0.040	P4HA3_HUMAN Prolyl 4-hydroxylase subunit alpha-3 OS=Homo sapiens OX=9606 GN=P4HA3 PE=1 SV=1
19	Q6W3E9	0.27	35.8	544	0.050	0.037	P4HA3_RAT Prolyl 4-hydroxylase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=P4ha3 PE=2 SV=1
20	Q5AX28	2.7	32.7	659	0.057	0.035	AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18909 dGTP_diPhyd_N	5.5	18.5	dATP/dGTP diphosphohydrolase, N-terminal
2	PF08528 Whi5	7.6e+02	11.2	Whi5 like
3	PF13525 YfiO	2e+02	13.1	Outer membrane lipoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323696

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300026	0.998	Peptidyl-prolyl cis-trans isomerase B
2	9606.ENSP00000236040	0.990	Prolyl 3-hydroxylase 1
3	9606.ENSP00000434412	0.982	Serpin H1
4	9606.ENSP00000327801	0.948	Protein disulfide-isomerase
5	9606.ENSP00000401749	0.915	Prolyl 4-hydroxylase subunit alpha-3
6	9606.ENSP00000384999	0.914	Prolyl 4-hydroxylase subunit alpha-2
7	9606.ENSP00000263556	0.913	Prolyl 4-hydroxylase subunit alpha-1
8	9606.ENSP00000225964	0.900	Collagen alpha-1(I) chain
9	9606.ENSP00000297268	0.900	Collagen alpha-2(I) chain
10	9606.ENSP00000317232	0.874	Peptidyl-prolyl cis-trans isomerase FKBP10
11	9606.ENSP00000364000	0.874	Collagen alpha-2(V) chain
12	9606.ENSP00000363824	0.835	Trimeric intracellular cation channel type B
13	9606.ENSP00000196061	0.829	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
14	9606.ENSP00000372059	0.810	Interferon-induced transmembrane protein 5
15	9606.ENSP00000480474	0.800	Collagen alpha-1(XIX) chain
16	9606.ENSP00000348385	0.794	Collagen alpha-1(XXVII) chain
17	9606.ENSP00000378340	0.788	Collagen alpha-6(IV) chain
18	9606.ENSP00000244728	0.785	Collagen type XXI alpha 1 chain
19	9606.ENSP00000261037	0.781	Collagen alpha-1(VIII) chain
20	9606.ENSP00000282903	0.770	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0044877	0.972	protein-containing complex binding
GO:0005518	0.938	collagen binding
GO:0003824	0.595	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0048519	0.926	negative regulation of biological process
GO:0009987	0.910	cellular process
GO:0032501	0.870	multicellular organismal process
GO:0032502	0.842	developmental process
GO:0008152	0.667	metabolic process
GO:0060255	0.655	regulation of macromolecule metabolic process
GO:0051171	0.646	regulation of nitrogen compound metabolic process
GO:0080090	0.645	regulation of primary metabolic process
GO:0031647	0.581	regulation of protein stability
GO:0071704	0.573	organic substance metabolic process
GO:0050794	0.565	regulation of cellular process
GO:0044238	0.458	primary metabolic process
GO:0051246	0.422	regulation of protein metabolic process
GO:0006807	0.407	nitrogen compound metabolic process
GO:0043170	0.352	macromolecule metabolic process
GO:0048856	0.328	anatomical structure development
GO:1901564	0.315	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0070013	0.997	intracellular organelle lumen
GO:0005576	0.973	extracellular region
GO:0005788	0.939	endoplasmic reticulum lumen
GO:0005615	0.868	extracellular space
GO:0071944	0.564	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]