StarFunc result for job id O75746

User Input

>input (678 residues)
MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLL
AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII
HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGL
DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA
GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL
PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS
GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR
DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL
YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD
VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL
LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF
KSPSVAVVQPKAAVAATQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75746	1.000	1.000	1.590E-101	678	1.000	1.000	O75746.pdb.gz	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
2	AFDB:Q9QXX4	0.519	0.520	3.055E-79	676	0.767	0.769	Q9QXX4.pdb.gz	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
3	AFDB:Q9VA73	0.512	0.500	2.319E-65	695	0.572	0.558	Q9VA73.pdb.gz	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
4	AFDB:Q5AL11	0.428	0.398	1.999E-38	731	0.361	0.335	Q5AL11.pdb.gz	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
5	AFDB:Q12482	0.407	0.310	3.005E-33	902	0.336	0.253	Q12482.pdb.gz	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
6	AFDB:Q9VGF7	0.376	0.768	1.049E-19	321	0.184	0.389	Q9VGF7.pdb.gz	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
7	AFDB:A0A0G2K5L2	0.376	0.760	2.487E-19	323	0.190	0.399	A0A0G2K5L2.pdb.gz	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
8	AFDB:Q9H1K4	0.376	0.779	4.361E-19	315	0.189	0.406	Q9H1K4.pdb.gz	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
9	AFDB:Q505J6	0.367	0.747	2.251E-18	320	0.184	0.391	Q505J6.pdb.gz	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
10	AFDB:Q9LY28	0.365	0.497	1.051E-16	479	0.140	0.198	Q9LY28.pdb.gz	MAPC3_ARATH Calcium-dependent mitochondrial ATP-magnesium/phosphate carrier protein 3 OS=Arabidopsis thaliana OX=3702 GN=APC3 PE=1 SV=1
11	PDB:4c9qB	0.349	0.763	1.466E-11	290	0.112	0.262	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
12	PDB:2c3eA	0.334	0.710	5.840E-11	293	0.122	0.283	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
13	PDB:6gciA	0.302	0.611	4.718E-8	292	0.111	0.257	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
14	PDB:6iihA	0.191	0.263	4.458E-7	446	0.090	0.137	6iihA.pdb.gz	The crystal structure of MICU2 provides insight into Ca2+binding and MICU1-MICU2 heterodimer formation.
15	PDB:6k7yI	0.190	0.350	4.339E-5	306	0.097	0.216	6k7yI.pdb.gz	Structure of intact human MCU supercomplex with the auxiliary MICU subunits.
16	PDB:6xjxQ	0.187	0.304	2.662E-4	367	0.112	0.207	6xjxQ.pdb.gz
17	PDB:1ggzA	0.083	0.298	4.410E-3	144	0.047	0.222	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:5d43A	0.102	0.354	5.967E-3	150	0.038	0.173	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
19	PDB:2f2pA	0.112	0.342	6.230E-3	169	0.053	0.213	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
20	PDB:7ukhI	0.147	0.420	9.190E-3	181	0.044	0.166	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LX07	0.0	1316	676	0.934	0.936	S2512_RAT Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a12 PE=3 SV=5
2	O75746	0.0	1398	678	1.000	1.000	S2512_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2
3	Q8BH59	0.0	1364	677	0.966	0.968	S2512_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1
4	Q9QXX4	0.0	1084	676	0.765	0.768	S2513_MOUSE Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a13 PE=1 SV=1
5	Q9UJS0	0.0	1093	675	0.768	0.772	S2513_HUMAN Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2
6	Q9VA73	0.0	793	695	0.583	0.568	CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster OX=7227 GN=aralar1 PE=2 SV=1
7	Q5AL11	5.21e-105	337	731	0.353	0.327	Q5AL11_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AGC1 PE=3 SV=1
8	Q12482	4.96e-95	315	902	0.249	0.187	AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AGC1 PE=3 SV=1
9	Q9VGF7	1.28e-65	221	321	0.176	0.371	Q9VGF7_DROME Glutamate carrier 1, isoform A OS=Drosophila melanogaster OX=7227 GN=GC1 PE=1 SV=1
10	Q8INJ3	1.28e-63	215	319	0.178	0.379	Q8INJ3_DROME AT03939p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
11	A0A0G2K5L2	4.13e-62	211	323	0.195	0.409	GHC1_RAT Mitochondrial glutamate carrier 1 OS=Rattus norvegicus OX=10116 GN=Slc25a22 PE=2 SV=1
12	Q9D6M3	8.28e-62	211	323	0.195	0.409	GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus OX=10090 GN=Slc25a22 PE=1 SV=1
13	Q9H936	1.07e-61	211	323	0.195	0.409	GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1
14	Q9H1K4	9.84e-61	207	315	0.187	0.403	GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens OX=9606 GN=SLC25A18 PE=1 SV=1
15	Q9DB41	3.23e-60	206	320	0.184	0.391	GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4
16	Q505J6	2.46e-58	201	320	0.178	0.378	GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus OX=10116 GN=Slc25a18 PE=2 SV=2
17	A8WHE0	3.79e-44	160	240	0.137	0.388	A8WHE0_DROME AT11783p OS=Drosophila melanogaster OX=7227 GN=GC2 PE=2 SV=1
18	Q9SUV1	6.63e-35	139	392	0.125	0.217	BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BT1 PE=1 SV=1
19	Q99297	7.01e-33	130	307	0.134	0.296	ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC2 PE=1 SV=1
20	Q03028	1.04e-32	130	310	0.139	0.303	ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ODC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	5.6e-08	42.8	EF hand
2	PF13202 EF-hand_5	2.2	19.1	EF hand
3	PF13405 EF-hand_6	1.3e-05	35.7	EF-hand domain
4	PF13499 EF-hand_7	1.7e-06	39.7	EF-hand domain pair
5	PF13833 EF-hand_8	11	17.2	EF-hand domain pair
6	PF00153 Mito_carr	1.7e-68	237.9	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215570	0.963	Mitochondrial import inner membrane translocase subunit Tim13
2	9606.ENSP00000361993	0.933	Mitochondrial import inner membrane translocase subunit Tim8 A
3	9606.ENSP00000317159	0.805	Cytochrome c1, heme protein, mitochondrial
4	9606.ENSP00000216254	0.796	Aconitate hydratase, mitochondrial
5	9606.ENSP00000464522	0.793	Mitochondrial import inner membrane translocase subunit Tim23
6	9606.ENSP00000347184	0.771	Huntingtin
7	9606.ENSP00000438455	0.758	Mitochondrial import inner membrane translocase subunit Tim8 B
8	9606.ENSP00000363211	0.749	Translocase of inner mitochondrial membrane 23 homolog B
9	9606.ENSP00000317780	0.719	Cytochrome c oxidase subunit 5A, mitochondrial
10	9606.ENSP00000330737	0.666	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
11	9606.ENSP00000378588	0.649	Mitochondrial import inner membrane translocase subunit Tim9
12	9606.ENSP00000432648	0.643	Protein yippee-like 4
13	9606.ENSP00000257245	0.622	Mitochondrial import inner membrane translocase subunit Tim10
14	9606.ENSP00000387262	0.621	MICOS complex subunit MIC60
15	9606.ENSP00000358737	0.617	ATP synthase F(0) complex subunit B1, mitochondrial
16	9606.ENSP00000380271	0.607	Rap guanine nucleotide exchange factor 4
17	9606.ENSP00000361471	0.547	Argininosuccinate synthase
18	9606.ENSP00000392709	0.529	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
19	9606.ENSP00000245206	0.517	Aspartate aminotransferase, mitochondrial
20	9606.ENSP00000356820	0.505	Mitochondrial pyruvate carrier 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.995	salt transmembrane transporter activity
GO:0042887	0.995	amide transmembrane transporter activity
GO:0015172	0.995	acidic amino acid transmembrane transporter activity
GO:0015179	0.994	L-amino acid transmembrane transporter activity
GO:0005488	0.987	binding
GO:0005515	0.971	protein binding
GO:0046872	0.948	metal ion binding
GO:0072349	0.942	modified amino acid transmembrane transporter activity
GO:0005509	0.942	calcium ion binding
GO:0015556	0.942	C4-dicarboxylate transmembrane transporter activity
GO:0015078	0.942	proton transmembrane transporter activity
GO:1901682	0.937	sulfur compound transmembrane transporter activity
GO:0005310	0.928	dicarboxylic acid transmembrane transporter activity
GO:0022804	0.919	active transmembrane transporter activity
GO:0015291	0.907	secondary active transmembrane transporter activity
GO:0015297	0.886	antiporter activity
GO:0042802	0.656	identical protein binding
GO:0000099	0.612	sulfur amino acid transmembrane transporter activity
GO:0022853	0.611	active monoatomic ion transmembrane transporter activity
GO:0015175	0.602	neutral L-amino acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006091	0.998	generation of precursor metabolites and energy
GO:1990542	0.991	mitochondrial transmembrane transport
GO:0022904	0.990	respiratory electron transport chain
GO:0071702	0.916	organic substance transport
GO:0044281	0.886	small molecule metabolic process
GO:0071704	0.873	organic substance metabolic process
GO:0015711	0.842	organic anion transport
GO:0044238	0.770	primary metabolic process
GO:0015849	0.709	organic acid transport
GO:0071705	0.589	nitrogen compound transport
GO:0009058	0.542	biosynthetic process
GO:0046942	0.487	carboxylic acid transport
GO:0006807	0.451	nitrogen compound metabolic process
GO:1901576	0.317	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0070013	0.479	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]