StarFunc result for job id O75747

User Input

>input (1445 residues)
MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDE
NTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQVSKAPAIGFSPSVLPKPQNT
NKECSWGSPIGKHHGADDSRFSILAPSFTSLDKINLEKELENENHNYHIGFESSIPPTNS
SFSSDFMPKEENKRSGHVNIVEPSLMLLKGSLQPGMWESTWQKNIESIGCSIQLVEVPQS
SNTSLASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFIDNSTQP
LHFMPCANYLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQNDHCLGSHKMFQKDKS
VIQLHLQKSREAPGKLSRKHEEDHSQFYLNQLLEFMHIWKVSRQCLLTLIRKYDFHLKYL
LKTQENVYNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKGENFYQSSETSAKGLIE
KVTTELSTSIYQLINVYCNSFYADFQPVNVPRCTSYLNPGLPSHLSFTVYAAHNIPETWV
HRINFPLEIKSLPRESMLTVKLFGIACATNNANLLAWTCLPLFPKEKSILGSMLFSMTLQ
SEPPVEMITPGVWDVSQPSPVTLQIDFPATGWEYMKPDSEENRSNLEEPLKECIKHIARL
SQKQTPLLLSEEKKRYLWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQ
PLEALGLLTSSFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLH
RSLQSIQVAHRLYWLLKNAENEAYFKSWYQKLLAALQFCAGKALNDEFSKEQKLIKILGD
IGERVKSASDHQRQEVLKKEIGRLEEFFQDVNTCHLPLNPALCIKGIDHDACSYFTSNAL
PLKITFINANPMGKNISIIFKAGDDLRQDMLVLQLIQVMDNIWLQEGLDMQMIIYRCLST
GKDQGLVQMVPDAVTLAKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCA
GWCVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEY
FITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMMLYAGLPELSGIQDLKYVYNN
LRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHTLAQMSAISPAKSTSQTFPQESCLLS
TTRSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPE
FPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQQTVEESSPVY
LGEKFPDKKPKVQLVISYEDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRK
TKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAINIRLCSVPLDKEKWYPL
GNSII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70167	0.793	0.762	0.000	1506	0.733	0.703	O70167.pdb.gz	P3C2G_MOUSE Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Mus musculus OX=10090 GN=Pik3c2g PE=1 SV=1
2	AFDB:O70173	0.793	0.762	0.000	1505	0.720	0.692	O70173.pdb.gz	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
3	AFDB:O75747	1.000	1.000	0.000	1445	1.000	1.000	O75747.pdb.gz	P3C2G_HUMAN Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens OX=9606 GN=PIK3C2G PE=1 SV=3
4	PDB:6pyuA	0.435	0.660	1.885E-39	930	0.164	0.255	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
5	PDB:4yknA	0.464	0.550	2.440E-39	1205	0.167	0.201	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
6	PDB:4ajwB	0.417	0.735	3.750E-39	792	0.155	0.283	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
7	PDB:7lq1A	0.465	0.690	6.843E-39	950	0.162	0.246	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
8	PDB:5itdA	0.459	0.651	8.127E-39	995	0.161	0.234	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
9	PDB:4ajwA	0.414	0.755	8.856E-39	765	0.151	0.285	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
10	PDB:6gy0A	0.434	0.737	2.707E-38	822	0.158	0.277	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
11	PDB:5dxtA	0.451	0.718	4.343E-38	879	0.154	0.254	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
12	PDB:7mezA	0.472	0.674	8.274E-38	989	0.165	0.241	7mezA.pdb.gz
13	PDB:5dxhD	0.452	0.653	1.118E-37	981	0.163	0.241	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
14	AFDB:Q6XK20	0.077	0.100	7.737E-3	1102	0.037	0.049	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
15	AFDB:P08678	0.052	0.039	1.264E-1	2026	0.045	0.032	P08678.pdb.gz	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
16	AFDB:F4J6F6	0.094	0.102	3.700E-1	1296	0.132	0.147	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
17	AFDB:A0A024QZV9	0.038	0.055	3.863E-1	834	0.073	0.126	A0A024QZV9.pdb.gz
18	AFDB:Q13009	0.052	0.052	4.209E-1	1591	0.087	0.079	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
19	AFDB:D1MYR8	0.056	0.079	6.197E-1	1007	0.037	0.053	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
20	AFDB:Q5AVI3	0.057	0.095	6.469E-1	838	0.038	0.066	Q5AVI3.pdb.gz	Q5AVI3_EMENI Cytoplasmic response regulator (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sskA PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RUF7	0.0	820	1634	0.338	0.299	A2RUF7_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=2 SV=1
2	E9QAN8	0.0	821	1632	0.340	0.301	E9QAN8_MOUSE Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Mus musculus OX=10090 GN=Pik3c2b PE=1 SV=1
3	F5GWN5	0.0	783	1606	0.331	0.298	F5GWN5_HUMAN Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=1
4	F6NMW9	0.0	752	1685	0.329	0.282	F6NMW9_DANRE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X2 OS=Danio rerio OX=7955 GN=pik3c2a PE=1 SV=1
5	L7RRS0	0.0	753	1686	0.328	0.281	L7RRS0_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=3 SV=1
6	O00443	0.0	753	1686	0.328	0.281	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
7	O00750	0.0	820	1634	0.338	0.299	P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2
8	O70167	0.0	2141	1506	0.733	0.703	P3C2G_MOUSE Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Mus musculus OX=10090 GN=Pik3c2g PE=1 SV=1
9	O70173	0.0	2115	1505	0.721	0.692	P3C2G_RAT Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus OX=10116 GN=Pik3c2g PE=1 SV=1
10	O75747	0.0	3001	1445	1.000	1.000	P3C2G_HUMAN Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens OX=9606 GN=PIK3C2G PE=1 SV=3
11	Q61194	0.0	753	1686	0.325	0.278	P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus OX=10090 GN=Pik3c2a PE=1 SV=2
12	Q7JNX6	3.53e-149	501	1876	0.269	0.207	Q7JNX6_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
13	Q7K3H0	7.68e-149	500	1876	0.269	0.207	Q7K3H0_DROME LD28067p OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=1
14	Q9VTN5	1.64e-148	499	1876	0.269	0.207	Q9VTN5_DROME Phosphoinositide 3-kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K68D PE=2 SV=2
15	G5EDY0	2.26e-107	377	1607	0.191	0.172	PIKI1_CAEEL Phosphatidylinositol 3-kinase piki-1 OS=Caenorhabditis elegans OX=6239 GN=piki-1 PE=1 SV=1
16	Q55FX5	3.58e-106	371	1382	0.156	0.164	Q55FX5_DICDI Phosphatidylinositol 3-kinase OS=Dictyostelium discoideum OX=44689 GN=pikF PE=3 SV=1
17	P54673	3.97e-103	364	1571	0.136	0.125	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2
18	P54675	1.45e-100	358	1697	0.132	0.113	PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum OX=44689 GN=pikC PE=2 SV=2
19	P54674	1.62e-98	352	1857	0.131	0.102	PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pikB PE=2 SV=2
20	P48736	2.34e-94	332	1102	0.129	0.169	PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PIK3CG PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.008	27.8	C2 domain
2	PF13575 DUF4135	1.1	20.0	Domain of unknown function (DUF4135)
3	PF00613 PI3Ka	1.7e-27	107.5	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
4	PF00792 PI3K_C2	0.0098	27.3	Phosphoinositide 3-kinase C2
5	PF00794 PI3K_rbd	1.1e-05	36.8	PI3-kinase family, ras-binding domain
6	PF00454 PI3_PI4_kinase	1.3e-47	174.3	Phosphatidylinositol 3- and 4-kinase
7	PF00787 PX	8.8e-08	44.1	PX domain
8	PF00273 Serum_albumin	8.9e+02	11.0	Serum albumin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361021	0.939	Phosphatase and tensin homolog
2	9606.ENSP00000264380	0.934	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000425487	0.931	Type II inositol 3,4-bisphosphate 4-phosphatase
4	9606.ENSP00000407586	0.930	GTPase HRas
5	9606.ENSP00000264864	0.929	Phosphatidylinositol 4-kinase type 2-beta
6	9606.ENSP00000298229	0.923	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
7	9606.ENSP00000222254	0.920	Phosphatidylinositol 3-kinase regulatory subunit beta
8	9606.ENSP00000354519	0.918	Phosphatidylinositide phosphatase SAC2
9	9606.ENSP00000373713	0.918	Phosphatidylinositide phosphatase SAC1
10	9606.ENSP00000255882	0.917	Phosphatidylinositol 4-kinase alpha
11	9606.ENSP00000074304	0.916	Type I inositol 3,4-bisphosphate 4-phosphatase
12	9606.ENSP00000359665	0.914	Phosphatidylinositol 4-kinase type 2-alpha
13	9606.ENSP00000360141	0.914	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
14	9606.ENSP00000348461	0.913	Ras-related C3 botulinum toxin substrate 1
15	9606.ENSP00000405338	0.913	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
16	9606.ENSP00000357869	0.911	Phosphatidylinositol 4-kinase beta
17	9606.ENSP00000428056	0.907	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000441600	0.907	C-C chemokine receptor type 3
19	9606.ENSP00000219789	0.906	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
20	9606.ENSP00000248572	0.906	Guanine nucleotide-binding protein G(T) subunit gamma-T1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016307	1.000	phosphatidylinositol phosphate kinase activity
GO:0016303	1.000	1-phosphatidylinositol-3-kinase activity
GO:0005515	0.995	protein binding
GO:0035005	0.946	1-phosphatidylinositol-4-phosphate 3-kinase activity
GO:0019899	0.374	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.960	cellular process
GO:0008152	0.798	metabolic process
GO:0071704	0.793	organic substance metabolic process
GO:0044238	0.791	primary metabolic process
GO:0044237	0.742	cellular metabolic process
GO:0065007	0.730	biological regulation
GO:0044788	0.726	modulation by host of viral process
GO:0008610	0.674	lipid biosynthetic process
GO:0046486	0.669	glycerolipid metabolic process
GO:0046488	0.655	phosphatidylinositol metabolic process
GO:0006661	0.654	phosphatidylinositol biosynthetic process
GO:0050789	0.652	regulation of biological process
GO:0050794	0.625	regulation of cellular process
GO:0050896	0.499	response to stimulus
GO:0051716	0.333	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.959	membrane
GO:0043227	0.942	membrane-bounded organelle
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0005886	0.567	plasma membrane
GO:0005634	0.563	nucleus
GO:0031981	0.526	nuclear lumen
GO:0005654	0.518	nucleoplasm
GO:0012505	0.375	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	1.000	phosphatidylinositol 3-kinase.
RHEA:18373	0.946	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+)
EC:2.7.1.154	0.946	phosphatidylinositol-4-phosphate 3-kinase.

[back to server]