StarFunc result for job id O75752

User Input

>input (331 residues)
MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYR
QDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQ
EAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYVMKTD
TDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSG
LGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
QLRRVIAAHGFSSKEIITFWQVMLRNTTCHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75752	1.000	1.000	6.870E-74	331	1.000	1.000	O75752.pdb.gz	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
2	AFDB:Q9Y2C3	0.794	0.846	2.116E-33	310	0.341	0.365	Q9Y2C3.pdb.gz	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
3	AFDB:O54904	0.759	0.770	3.615E-32	326	0.356	0.362	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
4	AFDB:Q9JI67	0.780	0.837	9.121E-32	308	0.326	0.351	Q9JI67.pdb.gz	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
5	AFDB:O43825	0.745	0.588	4.010E-31	422	0.308	0.242	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
6	AFDB:Q99NB2	0.774	0.683	2.722E-27	377	0.251	0.220	Q99NB2.pdb.gz	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
7	AFDB:Q9BYG0	0.777	0.684	4.460E-27	378	0.260	0.228	Q9BYG0.pdb.gz	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
8	AFDB:Q6ZMB0	0.728	0.631	1.273E-26	384	0.251	0.216	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
9	AFDB:Q9Y2A9	0.754	0.673	3.865E-26	372	0.227	0.202	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
10	AFDB:Q9C0J1	0.732	0.644	6.332E-26	378	0.281	0.246	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
11	PDB:7jhiC	0.688	0.688	2.354E-25	331	0.242	0.242	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:6fxrA	0.377	0.198	1.319E-5	700	0.082	0.039	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:4y63A	0.354	0.406	5.127E-5	282	0.088	0.103	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
14	PDB:1ll0B	0.412	0.491	2.550E-4	267	0.066	0.082	1ll0B.pdb.gz
15	PDB:4fixA	0.369	0.214	3.472E-4	629	0.076	0.040	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:2gamC	0.350	0.316	4.444E-4	374	0.069	0.061	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
17	PDB:7d72A	0.272	0.233	5.347E-4	407	0.085	0.069	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:8cvzI	0.373	0.443	7.279E-4	267	0.082	0.101	8cvzI.pdb.gz
19	PDB:2bo6A	0.360	0.323	1.435E-3	380	0.094	0.082	2bo6A.pdb.gz	Structural Dissection and High-Throughput Screening of Mannosylglyceerate Synthase
20	PDB:3r2wC	0.293	0.228	1.435E-3	450	0.085	0.062	3r2wC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75752	0.0	690	331	1.000	1.000	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1
2	Q920V1	0.0	613	331	0.934	0.934	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
3	Q9Y2C3	4.24e-67	214	310	0.317	0.339	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
4	Q9JI67	1.64e-66	213	308	0.323	0.347	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
5	O54904	4.33e-63	205	326	0.335	0.340	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
6	Q9Y5Z6	4.33e-63	205	326	0.335	0.340	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
7	O54905	2.13e-56	190	422	0.293	0.230	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
8	O43825	2.58e-55	187	422	0.290	0.227	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
9	Q8BGY6	4.31e-36	135	376	0.242	0.213	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
10	Q8NFL0	6.23e-36	135	401	0.275	0.227	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
11	Q9BYG0	2.13e-35	134	378	0.233	0.204	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
12	Q8K0J2	2.81e-35	134	397	0.266	0.222	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
13	Q99NB2	1.40e-34	132	377	0.239	0.210	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
14	Q6ZMB0	2.95e-34	131	384	0.257	0.221	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
15	Q9C0J1	6.04e-34	130	378	0.260	0.228	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
16	Q9Y2A9	2.85e-32	125	372	0.263	0.234	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
17	Q9VLS8	2.89e-31	125	585	0.254	0.144	Q9VLS8_DROME LD29807p OS=Drosophila melanogaster OX=7227 GN=GalT4 PE=1 SV=2
18	Q9Z222	6.59e-30	119	397	0.257	0.214	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
19	Q9NY97	8.32e-30	119	397	0.242	0.202	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
20	O96024	4.97e-29	117	378	0.221	0.193	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02434 Fringe	0.24	22.4	Fringe-like
2	PF01762 Galactosyl_T	9.2e-61	216.6	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384794	0.990	Lactosylceramide 4-alpha-galactosyltransferase
2	9606.ENSP00000361110	0.967	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
3	9606.ENSP00000379680	0.954	Alpha-N-acetylgalactosaminidase
4	9606.ENSP00000475261	0.943	Alpha-1,3-galactosyltransferase 2
5	9606.ENSP00000420161	0.937	Beta-1,4-galactosyltransferase 4
6	9606.ENSP00000369055	0.921	Beta-1,4-galactosyltransferase 1
7	9606.ENSP00000218516	0.914	Galactosidase alpha
8	9606.ENSP00000310696	0.913	Beta-1,4-galactosyltransferase 2
9	9606.ENSP00000480428	0.912	Beta-1,4-galactosyltransferase 3
10	9606.ENSP00000381699	0.904	Beta-1,3-galactosyltransferase 5
11	9606.ENSP00000261416	0.820	Beta-hexosaminidase subunit beta
12	9606.ENSP00000238714	0.819	Poly(A) polymerase gamma
13	9606.ENSP00000268097	0.811	Beta-hexosaminidase subunit alpha
14	9606.ENSP00000363746	0.764	WD repeat-containing protein 46
15	9606.ENSP00000396421	0.752	NXPE family member 3
16	9606.ENSP00000398744	0.712	Adenosine deaminase-like protein
17	9606.ENSP00000478982	0.705	Ribonuclease P protein subunit p38
18	9606.ENSP00000312021	0.662	Galactoside 2-alpha-L-fucosyltransferase 1
19	9606.ENSP00000386895	0.662	Protein FAM124B
20	9606.ENSP00000360850	0.660	Mitochondrial ribosomal protein S2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048531	0.999	beta-1,3-galactosyltransferase activity
GO:0035250	0.999	UDP-galactosyltransferase activity
GO:0005515	0.765	protein binding
GO:0008376	0.568	acetylgalactosaminyltransferase activity
GO:0008499	0.534	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:1901135	0.981	carbohydrate derivative metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0005975	0.933	carbohydrate metabolic process
GO:0009311	0.918	oligosaccharide metabolic process
GO:0006643	0.915	membrane lipid metabolic process
GO:0006664	0.910	glycolipid metabolic process
GO:1901576	0.890	organic substance biosynthetic process
GO:0006665	0.837	sphingolipid metabolic process
GO:0006687	0.783	glycosphingolipid metabolic process
GO:0016051	0.574	carbohydrate biosynthetic process
GO:1901137	0.564	carbohydrate derivative biosynthetic process
GO:0044249	0.550	cellular biosynthetic process
GO:1901566	0.482	organonitrogen compound biosynthetic process
GO:0009312	0.450	oligosaccharide biosynthetic process
GO:0043170	0.385	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	0.999	Hexosyltransferases.

[back to server]