StarFunc result for job id O75762

User Input

>input (1119 residues)
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75762	1.000	1.000	0.000	1119	1.000	1.000	O75762.pdb.gz	TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3
2	AFDB:Q6RI86	0.766	0.762	0.000	1125	0.799	0.795	Q6RI86.pdb.gz	TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1
3	AFDB:B6D5I6	0.483	0.485	6.981E-84	1115	0.487	0.489	B6D5I6.pdb.gz
4	AFDB:F1R8I6	0.636	0.635	9.642E-84	1120	0.464	0.463	F1R8I6.pdb.gz
5	PDB:6pqpA	0.495	0.859	2.118E-67	615	0.550	1.000	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
6	AFDB:G9L8C4	0.491	0.445	3.280E-65	1251	0.348	0.311	G9L8C4.pdb.gz	G9L8C4_DROME TRPA1(A) isoform OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=1
7	PDB:6v9xA	0.459	0.854	1.338E-57	571	0.508	0.995	6v9xA.pdb.gz
8	AFDB:Q18297	0.374	0.350	6.312E-44	1211	0.252	0.233	Q18297.pdb.gz	TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5
9	AFDB:Q9VMR4	0.254	0.180	1.280E-30	1761	0.214	0.136	Q9VMR4.pdb.gz	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
10	PDB:8cs9A	0.367	0.502	1.446E-28	796	0.164	0.231	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
11	AFDB:G5E8K5	0.365	0.226	1.690E-27	1961	0.150	0.086	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
12	AFDB:Q8N8A2	0.325	0.360	2.068E-27	993	0.164	0.185	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
13	AFDB:Q9W0T5	0.317	0.361	3.097E-27	956	0.189	0.221	Q9W0T5.pdb.gz	PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster OX=7227 GN=pyx PE=2 SV=2
14	PDB:5vkqA	0.384	0.297	3.232E-26	1499	0.182	0.136	5vkqA.pdb.gz
15	PDB:6dmwA	0.249	0.391	3.872E-12	631	0.105	0.185	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
16	PDB:7lp9A	0.235	0.390	4.551E-12	634	0.102	0.180	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
17	PDB:4oauC	0.208	0.319	6.286E-12	692	0.075	0.121	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
18	PDB:6e2fC	0.255	0.398	8.008E-12	647	0.107	0.185	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
19	PDB:6mhvA	0.222	0.375	1.199E-11	613	0.115	0.210	6mhvA.pdb.gz
20	PDB:6pvpA	0.230	0.366	1.656E-11	661	0.116	0.197	6pvpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6D5I5	0.0	1023	1107	0.466	0.471	B6D5I5_DANRE Transient receptor potential cation channel subfamily A member 1 isoform X1 OS=Danio rerio OX=7955 GN=trpa1l PE=2 SV=1
2	G9L8C4	0.0	664	1251	0.353	0.316	G9L8C4_DROME TRPA1(A) isoform OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=1
3	O75762	0.0	2333	1119	1.000	1.000	TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3
4	Q5UM14	0.0	1013	1120	0.466	0.465	Q5UM14_DANRE TRPA2 OS=Danio rerio OX=7955 GN=trpa2 PE=2 SV=1
5	Q5UM15	0.0	1055	1115	0.488	0.490	Q5UM15_DANRE TRPA1 OS=Danio rerio OX=7955 GN=ANKTM1 PE=2 SV=1
6	Q6RI86	0.0	1870	1125	0.800	0.796	TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1
7	Q7Z020	0.0	666	1197	0.353	0.330	TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4
8	Q8BLA8	0.0	1867	1125	0.801	0.796	TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1
9	Q18297	8.45e-78	281	1211	0.246	0.227	TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5
10	X2JCM1	2.48e-47	188	11634	0.150	0.014	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	M9MRX4	2.54e-47	188	13559	0.150	0.012	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	A0A5F9ZH38	2.61e-46	184	1739	0.144	0.093	A0A5F9ZH38_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZH34	6.18e-46	183	1689	0.139	0.092	A0A5F9ZH34_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHT4	9.05e-46	183	3870	0.148	0.043	A0A5F9ZHT4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZHT8	9.14e-46	183	3891	0.148	0.043	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZHF7	9.28e-46	183	3862	0.148	0.043	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI46	9.29e-46	183	3882	0.148	0.043	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	Q7KU95	1.37e-45	182	2404	0.140	0.065	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JGD3	1.38e-45	182	2566	0.140	0.061	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A8JNM4	1.68e-45	182	2532	0.140	0.062	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.8e-58	203.8	Ankyrin repeat
2	PF12796 Ank_2	3.1e-74	256.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-54	185.8	Ankyrin repeat
4	PF13637 Ank_4	5.7e-56	197.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	7.9e-49	174.4	Ankyrin repeats (many copies)
6	PF00520 Ion_trans	4.6e-10	50.7	Ion transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262209

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000461007	0.992	Transient receptor potential cation channel subfamily V member 1
2	9606.ENSP00000459962	0.990	Transient receptor potential cation channel, subfamily V, member 1
3	9606.ENSP00000323926	0.960	Transient receptor potential cation channel subfamily M member 8
4	9606.ENSP00000370034	0.924	Toll-like receptor 7
5	9606.ENSP00000306124	0.892	Protein kinase C epsilon type
6	9606.ENSP00000342222	0.892	Transient receptor potential cation channel subfamily V member 2
7	9606.ENSP00000347748	0.855	Transmembrane protein adipocyte associated 1
8	9606.ENSP00000421377	0.816	Piezo-type mechanosensitive ion channel component 2
9	9606.ENSP00000299163	0.807	Hypoxia-inducible factor 1-alpha inhibitor
10	9606.ENSP00000368966	0.802	Short transient receptor potential channel 3
11	9606.ENSP00000369027	0.802	Short transient receptor potential channel 4
12	9606.ENSP00000366314	0.788	Transient receptor potential cation channel subfamily M member 3
13	9606.ENSP00000390600	0.781	Sodium channel protein type 10 subunit alpha
14	9606.ENSP00000265023	0.767	Kininogen-1
15	9606.ENSP00000262839	0.763	Short transient receptor potential channel 5
16	9606.ENSP00000331746	0.759	Calcitonin
17	9606.ENSP00000320239	0.752	Transient receptor potential cation channel subfamily M member 7
18	9606.ENSP00000419313	0.746	Short transient receptor potential channel 1
19	9606.ENSP00000265310	0.744	Transient receptor potential cation channel subfamily V member 5
20	9606.ENSP00000321106	0.740	Protachykinin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005262	1.000	calcium channel activity
GO:0022839	0.999	monoatomic ion gated channel activity
GO:0042802	0.939	identical protein binding
GO:0022834	0.878	ligand-gated channel activity
GO:0099094	0.871	ligand-gated monoatomic cation channel activity
GO:0015278	0.846	calcium-release channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.991	cellular process
GO:0006811	0.975	monoatomic ion transport
GO:0032501	0.959	multicellular organismal process
GO:0006816	0.893	calcium ion transport
GO:0003008	0.870	system process
GO:0065007	0.858	biological regulation
GO:0042221	0.821	response to chemical
GO:0007600	0.797	sensory perception
GO:0050789	0.796	regulation of biological process
GO:0034220	0.771	monoatomic ion transmembrane transport
GO:0051716	0.764	cellular response to stimulus
GO:0050794	0.757	regulation of cellular process
GO:0098662	0.664	inorganic cation transmembrane transport
GO:0006950	0.657	response to stress
GO:0010033	0.651	response to organic substance
GO:0098655	0.647	monoatomic cation transmembrane transport
GO:1901700	0.604	response to oxygen-containing compound
GO:0019233	0.539	sensory perception of pain
GO:0010035	0.429	response to inorganic substance
GO:0007154	0.384	cell communication
GO:0023052	0.371	signaling
GO:0070588	0.336	calcium ion transmembrane transport
GO:0070887	0.326	cellular response to chemical stimulus
GO:0048518	0.318	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.758	organelle
GO:0005622	0.577	intracellular anatomical structure
GO:0043227	0.460	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]