StarFunc result for job id O75791

User Input

>input (330 residues)
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75791	1.000	1.000	3.753E-58	330	1.000	1.000	O75791.pdb.gz	GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1
2	AFDB:O89100	0.757	0.774	1.430E-49	322	0.858	0.879	O89100.pdb.gz	GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus OX=10090 GN=Grap2 PE=1 SV=1
3	AFDB:P87379	0.460	0.652	5.076E-26	229	0.342	0.493	P87379.pdb.gz	GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis OX=8355 GN=grb2-a PE=1 SV=2
4	AFDB:Q13588	0.421	0.631	6.696E-25	217	0.312	0.475	Q13588.pdb.gz	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
5	AFDB:P29355	0.428	0.615	2.240E-24	228	0.300	0.434	P29355.pdb.gz	SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans OX=6239 GN=sem-5 PE=1 SV=1
6	AFDB:Q08012	0.431	0.666	4.096E-24	211	0.306	0.479	Q08012.pdb.gz	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
7	PDB:1griA	0.303	0.458	5.699E-20	211	0.333	0.521	1griA.pdb.gz
8	AFDB:P52735	0.283	0.113	7.628E-17	878	0.218	0.082	P52735.pdb.gz	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
9	PDB:2h8hA	0.269	0.203	3.962E-12	445	0.136	0.101	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	PDB:1k9aB	0.255	0.193	1.946E-11	441	0.145	0.109	1k9aB.pdb.gz
11	AFDB:P46109	0.251	0.273	3.593E-11	303	0.167	0.182	P46109.pdb.gz	CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1
12	AFDB:Q6PH06	0.251	0.271	3.795E-11	305	0.139	0.151	Q6PH06.pdb.gz	Q6PH06_DANRE Crk-like protein OS=Danio rerio OX=7955 GN=wu:fj60e01 PE=1 SV=1
13	AFDB:F1NQU9	0.269	0.172	5.573E-11	534	0.152	0.094	F1NQU9.pdb.gz	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
14	PDB:3qwyA	0.241	0.452	1.961E-8	170	0.124	0.241	3qwyA.pdb.gz
15	PDB:4gwfA	0.253	0.173	1.078E-6	497	0.130	0.087	4gwfA.pdb.gz
16	PDB:3ps5A	0.244	0.154	2.324E-6	529	0.127	0.079	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
17	PDB:2lqnA	0.223	0.240	2.894E-6	303	0.164	0.178	2lqnA.pdb.gz
18	PDB:4k2rA	0.263	0.161	1.976E-5	551	0.073	0.044	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:4fl2A	0.257	0.157	2.205E-5	555	0.082	0.049	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
20	PDB:1ka6A	0.252	0.714	2.330E-5	107	0.061	0.187	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75791	0.0	686	330	1.000	1.000	GRAP2_HUMAN GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1
2	O89100	0.0	553	322	0.855	0.876	GRAP2_MOUSE GRB2-related adaptor protein 2 OS=Mus musculus OX=10090 GN=Grap2 PE=1 SV=1
3	Q6FI14	0.0	686	330	1.000	1.000	Q6FI14_HUMAN GRAP2 protein OS=Homo sapiens OX=9606 GN=GRAP2 PE=2 SV=1
4	P87379	4.63e-52	173	229	0.261	0.376	GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis OX=8355 GN=grb2-a PE=1 SV=2
5	Q6GPJ9	1.31e-51	172	229	0.261	0.376	GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis OX=8355 GN=grb2-b PE=1 SV=1
6	Q60631	2.54e-50	168	217	0.242	0.369	GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus OX=10090 GN=Grb2 PE=1 SV=1
7	B0LPF3	2.60e-50	168	217	0.242	0.369	B0LPF3_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=2 SV=1
8	G1SR27	2.60e-50	168	217	0.242	0.369	G1SR27_RABIT Growth factor receptor bound protein 2 OS=Oryctolagus cuniculus OX=9986 GN=GRB2 PE=1 SV=1
9	P62993	2.60e-50	168	217	0.242	0.369	GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1
10	P62994	2.60e-50	168	217	0.242	0.369	GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus OX=10116 GN=Grb2 PE=1 SV=1
11	Q13588	8.34e-49	164	217	0.239	0.364	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
12	Q07883	3.12e-48	163	217	0.242	0.369	GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus OX=9031 GN=GRB2 PE=1 SV=1
13	Q08012	1.43e-46	158	211	0.230	0.360	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
14	P29355	1.25e-43	151	228	0.236	0.342	SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans OX=6239 GN=sem-5 PE=1 SV=1
15	Q8TC17	1.67e-23	95.5	118	0.142	0.398	GRAPL_HUMAN GRB2-related adapter protein-like OS=Homo sapiens OX=9606 GN=GRAPL PE=1 SV=3
16	Q62662	5.18e-21	95.5	506	0.179	0.117	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
17	Q2PYT4	3.06e-19	90.9	1143	0.152	0.044	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
18	P00520	3.08e-19	90.9	1123	0.152	0.045	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
19	E9PT20	3.18e-19	90.9	1143	0.152	0.044	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
20	P00519	3.64e-19	90.9	1130	0.152	0.044	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17295 DUF5348	0.76	21.1	Domain of unknown function (DUF5348)
2	PF09326 NADH_dhqG_C	3.4e+02	13.4	NADH-ubiquinone oxidoreductase subunit G, C-terminal
3	PF00017 SH2	3.3e-19	80.1	SH2 domain
4	PF14633 SH2_2	7.6	17.4	SH2 domain
5	PF00018 SH3_1	7.6e-27	104.0	SH3 domain
6	PF07653 SH3_2	1.9e-15	67.7	Variant SH3 domain
7	PF08239 SH3_3	15	17.4	Bacterial SH3 domain
8	PF14604 SH3_9	1.8e-23	93.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339186

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000244007	0.998	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
3	9606.ENSP00000401303	0.998	SHC-transforming protein 1
4	9606.ENSP00000465039	0.998	Mitogen-activated protein kinase kinase kinase kinase 1
5	9606.ENSP00000378845	0.996	Linker for activation of T cells
6	9606.ENSP00000264972	0.990	Tyrosine-protein kinase ZAP-70
7	9606.ENSP00000264033	0.988	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000324890	0.981	T-cell-specific surface glycoprotein CD28
9	9606.ENSP00000427114	0.980	FYN-binding protein 1
10	9606.ENSP00000011653	0.969	T-cell surface glycoprotein CD4
11	9606.ENSP00000398655	0.969	Tyrosine-protein kinase ITK/TSK
12	9606.ENSP00000265562	0.966	Tyrosine-protein phosphatase non-receptor type 23
13	9606.ENSP00000303939	0.963	Cytotoxic T-lymphocyte protein 4
14	9606.ENSP00000365891	0.963	Wiskott-Aldrich syndrome protein
15	9606.ENSP00000275493	0.960	Epidermal growth factor receptor
16	9606.ENSP00000300692	0.958	T-cell surface glycoprotein CD3 delta chain
17	9606.ENSP00000354782	0.958	T-cell surface glycoprotein CD3 zeta chain
18	9606.ENSP00000387784	0.958	Son of sevenless homolog 1
19	9606.ENSP00000300574	0.951	Adapter molecule crk
20	9606.ENSP00000379721	0.948	Ubiquitin carboxyl-terminal hydrolase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.385	enzyme binding
GO:0098772	0.311	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.987	cellular response to stimulus
GO:0007165	0.982	signal transduction
GO:0048518	0.785	positive regulation of biological process
GO:0048583	0.712	regulation of response to stimulus
GO:0035556	0.702	intracellular signal transduction
GO:0048522	0.691	positive regulation of cellular process
GO:0007265	0.619	Ras protein signal transduction
GO:0007267	0.615	cell-cell signaling
GO:0048584	0.461	positive regulation of response to stimulus
GO:0007166	0.428	cell surface receptor signaling pathway
GO:0019222	0.388	regulation of metabolic process
GO:0002682	0.387	regulation of immune system process
GO:0032501	0.381	multicellular organismal process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0008152	0.355	metabolic process
GO:0071704	0.341	organic substance metabolic process
GO:0009966	0.335	regulation of signal transduction
GO:0048519	0.332	negative regulation of biological process
GO:0002376	0.327	immune system process
GO:0002684	0.306	positive regulation of immune system process
GO:0050776	0.303	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0031981	0.998	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0012505	0.899	endomembrane system
GO:0031982	0.828	vesicle
GO:0097708	0.797	intracellular vesicle
GO:0031410	0.756	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]