StarFunc result for job id O75807

User Input

>input (674 residues)
MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGL
EGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGE
REATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYP
PSHRECCPAVEEEDDEEAVKKEAHRTSTSALSPGSKPSTWVSCPGEEENQATEDKRTERS
KGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLK
SWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDE
DSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSA
STPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFR
GWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPET
PTHDPDPETPLKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQ
EELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLSQAVATPSRSS
AAAAAALDLSGRRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75807	0.999	0.999	3.403E-91	674	1.000	1.000	O75807.pdb.gz	PR15A_HUMAN Protein phosphatase 1 regulatory subunit 15A OS=Homo sapiens OX=9606 GN=PPP1R15A PE=1 SV=1
2	AFDB:P17564	0.184	0.188	1.034E-31	657	0.470	0.482	P17564.pdb.gz	PR15A_MOUSE Protein phosphatase 1 regulatory subunit 15A OS=Mus musculus OX=10090 GN=Ppp1r15a PE=1 SV=1
3	AFDB:Q8MYV4	0.067	0.050	4.154E-3	1000	0.157	0.106	Q8MYV4.pdb.gz	Q8MYV4_DROME RH35718p OS=Drosophila melanogaster OX=7227 GN=CG1677 PE=2 SV=1
4	AFDB:Q6QR58	0.066	0.064	1.441E-2	705	0.129	0.123	Q6QR58.pdb.gz	Q6QR58_ICTPU E-box binding protein 1 OS=Ictalurus punctatus OX=7998 GN=tcf12 PE=2 SV=1
5	AFDB:Q3TXU6	0.075	0.065	2.279E-2	800	0.174	0.146	Q3TXU6.pdb.gz	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
6	AFDB:Q5TC82	0.055	0.038	2.279E-2	1133	0.139	0.083	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
7	AFDB:Q4G5U4	0.072	0.066	2.961E-2	753	0.159	0.142	Q4G5U4.pdb.gz
8	AFDB:Q10124	0.062	0.031	3.162E-2	1647	0.144	0.059	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
9	AFDB:Q9C0I3	0.075	0.060	3.376E-2	900	0.157	0.118	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
10	AFDB:Q4G5U2	0.080	0.079	3.604E-2	685	0.156	0.153	Q4G5U2.pdb.gz
11	PDB:6n7pA	0.060	0.157	1.501	186	0.028	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
12	PDB:7mqaSI	0.058	0.050	1.602	803	0.027	0.022	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq9SI	0.065	0.054	2.082	844	0.025	0.020	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7w59R	0.065	0.134	2.373	280	0.042	0.100	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:3jb9M	0.043	0.105	3.084	207	0.039	0.126	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:7d63RJ	0.075	0.065	3.292	796	0.025	0.021	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
17	PDB:7ajtCL	0.064	0.057	3.753	781	0.027	0.023	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:4v6wCW	0.051	0.155	4.278	130	0.019	0.100	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:6ff4C	0.062	0.125	4.278	286	0.043	0.101	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7qsmZ	0.061	0.226	4.278	142	0.031	0.148	7qsmZ.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75807	0.0	1323	674	1.000	1.000	PR15A_HUMAN Protein phosphatase 1 regulatory subunit 15A OS=Homo sapiens OX=9606 GN=PPP1R15A PE=1 SV=1
2	P17564	1.68e-126	391	657	0.478	0.490	PR15A_MOUSE Protein phosphatase 1 regulatory subunit 15A OS=Mus musculus OX=10090 GN=Ppp1r15a PE=1 SV=1
3	Q6IN02	2.06e-122	378	578	0.448	0.522	PR15A_RAT Protein phosphatase 1 regulatory subunit 15A OS=Rattus norvegicus OX=10116 GN=Ppp1r15a PE=2 SV=2
4	Q9W1E4	2.10e-08	58.5	317	0.045	0.095	Q9W1E4_DROME GH11727p OS=Drosophila melanogaster OX=7227 GN=PPP1R15 PE=2 SV=1
5	Q5SWA1	7.93e-08	58.2	713	0.043	0.041	PR15B_HUMAN Protein phosphatase 1 regulatory subunit 15B OS=Homo sapiens OX=9606 GN=PPP1R15B PE=1 SV=2
6	Q8BFW3	1.74e-06	53.5	697	0.039	0.037	PR15B_MOUSE Protein phosphatase 1 regulatory subunit 15B OS=Mus musculus OX=10090 GN=Ppp1r15b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10488 PP1c_bdg	2.1e-07	42.4	Phosphatase-1 catalytic subunit binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000200453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.999	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000262158	0.998	Mothers against decapentaplegic homolog 7
3	9606.ENSP00000341779	0.998	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
4	9606.ENSP00000256383	0.994	Eukaryotic translation initiation factor 2 subunit 1
5	9606.ENSP00000336790	0.964	Cyclic AMP-dependent transcription factor ATF-4
6	9606.ENSP00000378769	0.940	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
7	9606.ENSP00000287727	0.939	Zinc finger FYVE domain-containing protein 9
8	9606.ENSP00000364119	0.938	Eukaryotic translation initiation factor 2 subunit 2
9	9606.ENSP00000364133	0.931	TGF-beta receptor type-1
10	9606.ENSP00000253039	0.922	Eukaryotic translation initiation factor 2 subunit 3
11	9606.ENSP00000337159	0.914	Zinc finger FYVE domain-containing protein 16
12	9606.ENSP00000363708	0.908	Bone morphogenetic protein receptor type-2
13	9606.ENSP00000426568	0.906	Mothers against decapentaplegic homolog 1
14	9606.ENSP00000221930	0.905	Transforming growth factor beta-1
15	9606.ENSP00000351905	0.903	TGF-beta receptor type-2
16	9606.ENSP00000245451	0.901	Bone morphogenetic protein 4
17	9606.ENSP00000238682	0.900	Transforming growth factor beta-3
18	9606.ENSP00000308219	0.900	RGM domain family member B
19	9606.ENSP00000337014	0.900	Hemojuvelin
20	9606.ENSP00000361107	0.900	Bone morphogenetic protein receptor type-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0008157	1.000	protein phosphatase 1 binding
GO:0072542	1.000	protein phosphatase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0019222	0.976	regulation of metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0048522	0.970	positive regulation of cellular process
GO:0044237	0.969	cellular metabolic process
GO:0010556	0.960	regulation of macromolecule biosynthetic process
GO:0031326	0.960	regulation of cellular biosynthetic process
GO:0010646	0.956	regulation of cell communication
GO:0006807	0.954	nitrogen compound metabolic process
GO:0051716	0.950	cellular response to stimulus
GO:0023051	0.950	regulation of signaling
GO:0010468	0.949	regulation of gene expression
GO:0009893	0.948	positive regulation of metabolic process
GO:0006796	0.940	phosphate-containing compound metabolic process
GO:0048583	0.939	regulation of response to stimulus
GO:0019538	0.937	protein metabolic process
GO:0010557	0.935	positive regulation of macromolecule biosynthetic process
GO:0031328	0.934	positive regulation of cellular biosynthetic process
GO:0036211	0.932	protein modification process
GO:0048519	0.931	negative regulation of biological process
GO:0009966	0.931	regulation of signal transduction
GO:0080134	0.926	regulation of response to stress
GO:0051247	0.925	positive regulation of protein metabolic process
GO:0007165	0.922	signal transduction
GO:0080135	0.917	regulation of cellular response to stress
GO:0065009	0.906	regulation of molecular function
GO:0006950	0.906	response to stress
GO:0033554	0.893	cellular response to stress
GO:0042327	0.893	positive regulation of phosphorylation
GO:0048585	0.889	negative regulation of response to stimulus
GO:0016311	0.888	dephosphorylation
GO:0048523	0.880	negative regulation of cellular process
GO:0010605	0.869	negative regulation of macromolecule metabolic process
GO:0031401	0.851	positive regulation of protein modification process
GO:0051172	0.848	negative regulation of nitrogen compound metabolic process
GO:0035303	0.844	regulation of dephosphorylation
GO:0031400	0.834	negative regulation of protein modification process
GO:0035304	0.823	regulation of protein dephosphorylation
GO:1905897	0.820	regulation of response to endoplasmic reticulum stress
GO:0050790	0.815	regulation of catalytic activity
GO:0001933	0.813	negative regulation of protein phosphorylation
GO:0035306	0.812	positive regulation of dephosphorylation
GO:0035967	0.798	cellular response to topologically incorrect protein
GO:0034248	0.781	regulation of amide metabolic process
GO:0034976	0.778	response to endoplasmic reticulum stress
GO:2000112	0.772	regulation of cellular macromolecule biosynthetic process
GO:0010608	0.768	post-transcriptional regulation of gene expression
GO:1903573	0.765	negative regulation of response to endoplasmic reticulum stress
GO:0006446	0.760	regulation of translational initiation
GO:0043666	0.740	regulation of phosphoprotein phosphatase activity
GO:0035307	0.736	positive regulation of protein dephosphorylation
GO:0035556	0.709	intracellular signal transduction
GO:0051179	0.703	localization
GO:0071840	0.686	cellular component organization or biogenesis
GO:0044093	0.670	positive regulation of molecular function
GO:0016043	0.663	cellular component organization
GO:0010628	0.589	positive regulation of gene expression
GO:0019219	0.582	regulation of nucleobase-containing compound metabolic process
GO:0006986	0.538	response to unfolded protein
GO:0034620	0.516	cellular response to unfolded protein
GO:0051641	0.514	cellular localization
GO:0030968	0.509	endoplasmic reticulum unfolded protein response
GO:0051252	0.468	regulation of RNA metabolic process
GO:0006355	0.463	regulation of DNA-templated transcription
GO:0009968	0.451	negative regulation of signal transduction
GO:0051128	0.446	regulation of cellular component organization
GO:0033036	0.433	macromolecule localization
GO:0006470	0.415	protein dephosphorylation
GO:0006915	0.401	apoptotic process
GO:0008104	0.394	protein localization
GO:0065008	0.366	regulation of biological quality
GO:0051726	0.344	regulation of cell cycle
GO:0045935	0.344	positive regulation of nucleobase-containing compound metabolic process
GO:0097190	0.316	apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005783	0.999	endoplasmic reticulum
GO:1902494	0.991	catalytic complex
GO:0005739	0.965	mitochondrion
GO:1903293	0.940	phosphatase complex
GO:0043233	0.923	organelle lumen
GO:0070013	0.909	intracellular organelle lumen
GO:0008287	0.907	protein serine/threonine phosphatase complex
GO:0005794	0.890	Golgi apparatus
GO:0000164	0.861	protein phosphatase type 1 complex
GO:0005634	0.770	nucleus
GO:0031090	0.660	organelle membrane
GO:0031981	0.340	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]