StarFunc result for job id O75808

User Input

>input (1086 residues)
MATVGEWSCVRCTFLNPAGQRQCSICEAPRHKPDLNHILRLSVEEQKWPCARCTFRNFLG
KEACEVCGFTPEPAPGAAFLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGLVATEPAR
GQCEDKDEEEKEEQEEEEGAAEPRGGWACPRCTLHNTPVASSCSVCGGPRRLSLPRIPPE
ALVVPEVVAPAGFHVVPAAPPPGLPGEGAEANPPATSQGPAAEPEPPRVPPFSPFSSTLQ
NNPVPRSRREVPPQLQPPVPEAAQPSPSAGCRGAPQGSGWAGASRLAELLSGKRLSVLEE
EATEGGTSRVEAGSSTSGSDIIDLAGDTVRYTPASPSSPDFTTWSCAKCTLRNPTVAPRC
SACGCSKLHGFQEHGEPPTHCPDCGADKPSPCGRSCGRVSSAQKAARVLPERPGQWACPA
CTLLNALRAKHCAACHTPQLLVAQRRGAAPLRRRESMHVEQRRQTDEGEAKALWENIVAF
CRENNVSFVDDSFPPGPESVGFPAGDSVQQRVRQWLRPQEINCSVFRDHRATWSVFHTLR
PSDILQGLLGNCWFLSALAVLAERPDLVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDD
MLPCDEAGCLLFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLATLTGAPCESLA
LQLSSTNPREEPVDTDLIWAKMLSSKEAGFLMGASCGGGNMKVDDSAYESLGLRPRHAYS
ILDVRDVQGTRLLRLRNPWGRFSWNGSWSDEWPHWPGHLRGELMPHGSSEGVFWMEYGDF
VRYFDSVDICKVHSDWQEARVQGCFPSSASAPVGVTALTVLERASLEFALFQEGSRRSDA
VDSHLLDLCILVFRATFGSGGHLSLGRLLAHSKRAVKKFVSCDVMLEPGEYAVVCCAFNH
WGPPLPGTPAPQASSPSAGVPRASPEPPGHVLAVYSSRLVMVEPVEAQPTTLADAIILLT
ESRGERHEGREGMTCYYLTHGWAGLIVVVENRHPKAYLHVQCDCTDSFNVVSTRGSLRTQ
DSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGL
HGPRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75808	1.000	1.000	0.000	1086	1.000	1.000	O75808.pdb.gz	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
2	PDB:1kfuL	0.332	0.496	2.688E-27	699	0.118	0.183	1kfuL.pdb.gz
3	PDB:1kfxL	0.312	0.510	2.292E-23	640	0.111	0.189	1kfxL.pdb.gz
4	AFDB:Q9C7M2	0.037	0.046	3.648E-3	849	0.073	0.093	Q9C7M2.pdb.gz	Q9C7M2_ARATH Uncharacterized protein F14C21.55 OS=Arabidopsis thaliana OX=3702 GN=SED1 PE=1 SV=1
5	PDB:5mhlA	0.063	0.089	3.973E-3	692	0.029	0.046	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
6	AFDB:P91457	0.049	0.045	8.639E-3	1217	0.076	0.068	P91457.pdb.gz	P91457_CAEEL RanBP2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-7 PE=1 SV=1
7	PDB:3gc3A	0.043	0.102	1.528E-2	329	0.023	0.076	3gc3A.pdb.gz
8	PDB:5f0jB	0.044	0.117	3.428E-2	306	0.029	0.105	5f0jB.pdb.gz
9	PDB:1mkfA	0.049	0.115	4.252E-2	371	0.027	0.078	1mkfA.pdb.gz
10	PDB:6l4cC	0.053	0.128	4.252E-2	353	0.029	0.088	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
11	PDB:7u05A	0.048	0.048	4.252E-2	1114	0.033	0.032	7u05A.pdb.gz
12	PDB:1ipkC	0.058	0.123	4.998E-2	379	0.027	0.077	1ipkC.pdb.gz
13	PDB:6l4cB	0.059	0.132	5.275E-2	373	0.033	0.097	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
14	AFDB:Q9SB51	0.058	0.061	1.765E-1	1008	0.110	0.118	Q9SB51.pdb.gz	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
15	AFDB:B7YZW3	0.058	0.035	3.960E-1	2064	0.125	0.066	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
16	AFDB:Q8TEP8	0.053	0.033	8.419E-1	2537	0.120	0.051	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
17	AFDB:Q8VD37	0.063	0.078	8.419E-1	806	0.100	0.135	Q8VD37.pdb.gz	SGIP1_MOUSE SH3-containing GRB2-like protein 3-interacting protein 1 OS=Mus musculus OX=10090 GN=Sgip1 PE=1 SV=1
18	AFDB:A0A0R4IBX8	0.037	0.034	2.220	1267	0.059	0.051	A0A0R4IBX8.pdb.gz
19	AFDB:A0A0G2K6D0	0.063	0.052	3.237	1366	0.117	0.093	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
20	AFDB:A0A3B3IU55	0.065	0.070	3.805	977	0.109	0.121	A0A3B3IU55.pdb.gz	A0A3B3IU55_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75808	0.0	2203	1086	1.000	1.000	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
2	P27398	0.0	730	1594	0.345	0.235	CAND_DROME Calpain-D OS=Drosophila melanogaster OX=7227 GN=sol PE=1 SV=2
3	Q8RVL2	3.44e-53	206	2151	0.123	0.062	DEK1_ARATH Calpain-type cysteine protease DEK1 OS=Arabidopsis thaliana OX=3702 GN=DEK1 PE=1 SV=1
4	F4I0A4	4.71e-53	206	2179	0.123	0.061	F4I0A4_ARATH Calpain-type cysteine protease family OS=Arabidopsis thaliana OX=3702 GN=DEK1 PE=1 SV=1
5	Q8RVL1	1.45e-51	201	2159	0.115	0.058	DEK1_MAIZE Calpain-type cysteine protease DEK1 OS=Zea mays OX=4577 GN=DEK1 PE=1 SV=2
6	Q6ZFZ4	1.76e-51	201	2162	0.124	0.062	DEK1_ORYSJ Calpain-type cysteine protease ADL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ADL1 PE=1 SV=1
7	P20807	7.84e-42	168	821	0.135	0.179	CAN3_HUMAN Calpain-3 OS=Homo sapiens OX=9606 GN=CAPN3 PE=1 SV=2
8	Q9UMQ6	1.18e-41	166	739	0.106	0.156	CAN11_HUMAN Calpain-11 OS=Homo sapiens OX=9606 GN=CAPN11 PE=2 SV=2
9	P97571	6.11e-41	164	713	0.109	0.165	CAN1_RAT Calpain-1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn1 PE=1 SV=1
10	Q64691	5.87e-40	162	821	0.134	0.177	CAN3_MOUSE Calpain-3 OS=Mus musculus OX=10090 GN=Capn3 PE=1 SV=2
11	P35750	7.89e-40	160	714	0.103	0.157	CAN1_PIG Calpain-1 catalytic subunit OS=Sus scrofa OX=9823 GN=CAPN1 PE=2 SV=3
12	P16259	2.98e-39	160	821	0.133	0.175	CAN3_RAT Calpain-3 OS=Rattus norvegicus OX=10116 GN=Capn3 PE=2 SV=1
13	P07384	7.99e-38	154	714	0.101	0.154	CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1
14	F1QL66	3.31e-37	152	713	0.104	0.158	F1QL66_DANRE Calpain 12 OS=Danio rerio OX=7955 GN=si:ch211-160d20.1 PE=1 SV=2
15	Q92178	4.29e-37	152	700	0.100	0.156	CAN2_CHICK Calpain-2 catalytic subunit OS=Gallus gallus OX=9031 GN=CAPN2 PE=2 SV=3
16	B6V3H8	5.71e-37	151	700	0.100	0.156	B6V3H8_CHICK Calpain-2 catalytic subunit OS=Gallus gallus OX=9031 GN=CAPN2 PE=2 SV=1
17	O35350	6.06e-37	152	713	0.103	0.157	CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus OX=10090 GN=Capn1 PE=1 SV=1
18	Q6J756	1.48e-36	150	714	0.105	0.160	CAN11_MOUSE Calpain-11 OS=Mus musculus OX=10090 GN=Capn11 PE=1 SV=1
19	Q9VT65	1.51e-36	152	925	0.098	0.115	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2
20	Q07009	2.51e-36	149	700	0.103	0.160	CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	1.8	20.0	Double zinc ribbon
2	PF00648 Peptidase_C2	1.8e-81	285.0	Calpain family cysteine protease
3	PF00641 zf-RanBP	2.3e-17	73.3	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219611

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246533	0.816	Calpain small subunit 1
2	9606.ENSP00000400882	0.720	Calpain small subunit 2
3	9606.ENSP00000379157	0.703	Calpastatin
4	9606.ENSP00000480715	0.664	IQ domain-containing protein E
5	9606.ENSP00000360129	0.659	EF-hand calcium-binding domain-containing protein 7
6	9606.ENSP00000381064	0.653	Integrator complex subunit 10
7	9606.ENSP00000221418	0.604	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
8	9606.ENSP00000478874	0.581	Calcium/calmodulin-dependent protein kinase type 1D
9	9606.ENSP00000466121	0.568	Fanconi anemia core complex-associated protein 24
10	9606.ENSP00000301671	0.538	GH3 domain-containing protein
11	9606.ENSP00000357883	0.503	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.955	catalytic activity
GO:0016787	0.877	hydrolase activity
GO:0140096	0.800	catalytic activity, acting on a protein
GO:0008233	0.379	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0009987	0.918	cellular process
GO:1901564	0.893	organonitrogen compound metabolic process
GO:0019538	0.878	protein metabolic process
GO:0050789	0.868	regulation of biological process
GO:0050794	0.798	regulation of cellular process
GO:0006508	0.783	proteolysis
GO:0048518	0.302	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.995	organelle
GO:0005829	0.995	cytosol
GO:0043229	0.994	intracellular organelle
GO:0043227	0.993	membrane-bounded organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0031974	0.966	membrane-enclosed lumen
GO:0070013	0.964	intracellular organelle lumen
GO:0031981	0.926	nuclear lumen
GO:0005654	0.856	nucleoplasm
GO:0016020	0.522	membrane
GO:0030054	0.391	cell junction
GO:0005783	0.382	endoplasmic reticulum
GO:0110158	0.379	calpain complex
GO:0005925	0.377	focal adhesion
GO:0005886	0.375	plasma membrane
GO:0031143	0.367	pseudopodium
GO:0030864	0.367	cortical actin cytoskeleton
GO:0097038	0.364	perinuclear endoplasmic reticulum
GO:0045121	0.358	membrane raft
GO:0065010	0.358	extracellular membrane-bounded organelle
GO:0005794	0.358	Golgi apparatus
GO:0070062	0.316	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.877	Hydrolases.
EC:3.4.-.-	0.379	Acting on peptide bonds (peptidases).

[back to server]