StarFunc result for job id O75815

User Input

>input (825 residues)
MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPP
IRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKF
SKERHIMDRTPEKLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
ISQQSGAIIFQPINRTVPLRCLEEHYGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQARE
QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPC
PNSPVFRTGSEPALSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPS
AWLNSEANYCELNPAFATGCGRGAKLPSCAQGSHTELLTAKQNEAPGPRNSGVNYLILDD
DDRERPWEPAAAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRA
KELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIE
RHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQ
AVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKT
EFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75815	1.000	1.000	0.000	825	1.000	1.000	O75815.pdb.gz	BCAR3_HUMAN Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens OX=9606 GN=BCAR3 PE=1 SV=1
2	AFDB:D3ZAZ5	0.567	0.567	1.059E-89	825	0.859	0.859	D3ZAZ5.pdb.gz	BCAR3_RAT Breast cancer anti-estrogen resistance protein 3 homolog OS=Rattus norvegicus OX=10116 GN=Bcar3 PE=1 SV=1
3	AFDB:Q9BRG2	0.365	0.520	4.350E-36	576	0.286	0.410	Q9BRG2.pdb.gz	SH23A_HUMAN SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1
4	PDB:1griA	0.106	0.385	4.077E-4	211	0.042	0.166	1griA.pdb.gz
5	PDB:2byvE	0.189	0.170	4.647E-4	922	0.062	0.055	2byvE.pdb.gz
6	AFDB:Q5SX79	0.076	0.076	6.188E-4	823	0.149	0.149	Q5SX79.pdb.gz	SHRM1_MOUSE Protein Shroom1 OS=Mus musculus OX=10090 GN=Shroom1 PE=1 SV=2
7	PDB:1ka6A	0.094	0.656	7.190E-4	107	0.029	0.224	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
8	PDB:5xzrA	0.110	0.169	9.343E-4	519	0.045	0.071	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
9	AFDB:A0A1D8PMA5	0.073	0.068	1.140E-3	929	0.139	0.124	A0A1D8PMA5.pdb.gz	A0A1D8PMA5_CANAL mRNA-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUF3 PE=4 SV=1
10	PDB:4gwfA	0.111	0.180	1.162E-3	497	0.046	0.076	4gwfA.pdb.gz
11	PDB:1k9aB	0.106	0.192	1.722E-3	441	0.033	0.061	1k9aB.pdb.gz
12	PDB:2lqnA	0.106	0.267	2.337E-3	303	0.040	0.109	2lqnA.pdb.gz
13	PDB:3ps5A	0.112	0.172	2.664E-3	529	0.041	0.064	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:3cxlA	0.085	0.162	2.783E-3	402	0.025	0.052	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
15	AFDB:Q9P212	0.138	0.064	3.396E-3	2302	0.130	0.046	Q9P212.pdb.gz	PLCE1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Homo sapiens OX=9606 GN=PLCE1 PE=1 SV=3
16	PDB:4fl2A	0.111	0.162	3.461E-3	555	0.030	0.045	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	AFDB:F4K0Y5	0.060	0.058	9.267E-3	1165	0.148	0.105	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
18	AFDB:Q8K4S1	0.149	0.066	1.314E-2	2282	0.144	0.052	Q8K4S1.pdb.gz	PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus OX=10090 GN=Plce1 PE=1 SV=3
19	AFDB:F5HSE3	0.060	0.033	2.760E-2	2381	0.147	0.051	F5HSE3.pdb.gz	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
20	AFDB:F4HWC3	0.069	0.048	5.085E-2	1364	0.135	0.081	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZAZ5	0.0	1408	825	0.859	0.859	BCAR3_RAT Breast cancer anti-estrogen resistance protein 3 homolog OS=Rattus norvegicus OX=10116 GN=Bcar3 PE=1 SV=1
2	O75815	0.0	1713	825	1.000	1.000	BCAR3_HUMAN Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens OX=9606 GN=BCAR3 PE=1 SV=1
3	Q9QZK2	0.0	1392	820	0.855	0.860	BCAR3_MOUSE Breast cancer anti-estrogen resistance protein 3 homolog OS=Mus musculus OX=10090 GN=Bcar3 PE=1 SV=1
4	Q9QZS8	3.95e-179	538	854	0.393	0.379	SH2D3_MOUSE SH2 domain-containing protein 3C OS=Mus musculus OX=10090 GN=Sh2d3c PE=1 SV=1
5	Q8N5H7	1.70e-176	532	860	0.400	0.384	SH2D3_HUMAN SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C PE=1 SV=1
6	Q9BRG2	1.57e-109	348	576	0.295	0.422	SH23A_HUMAN SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1
7	P09760	5.64e-13	75.1	823	0.051	0.051	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
8	P70451	6.04e-13	75.1	823	0.051	0.051	FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus OX=10090 GN=Fer PE=1 SV=2
9	P16591	8.80e-13	74.7	822	0.046	0.046	FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2
10	W0S0X4	8.80e-13	74.7	822	0.046	0.046	W0S0X4_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=Pe1Fe3 PE=2 SV=1
11	Q22146	1.85e-10	65.9	390	0.047	0.100	FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans OX=6239 GN=frk-1 PE=1 SV=1
12	Q7SY37	1.34e-09	63.9	592	0.067	0.093	Q7SY37_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=zgc:63553 PE=2 SV=1
13	P98077	1.46e-09	63.9	582	0.042	0.060	SHC2_HUMAN SHC-transforming protein 2 OS=Homo sapiens OX=9606 GN=SHC2 PE=1 SV=4
14	S6CMQ2	1.47e-09	63.9	590	0.067	0.093	S6CMQ2_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=shp3 PE=2 SV=1
15	Q92529	1.60e-09	63.9	594	0.047	0.066	SHC3_HUMAN SHC-transforming protein 3 OS=Homo sapiens OX=9606 GN=SHC3 PE=1 SV=1
16	P16879	1.63e-09	63.9	822	0.041	0.041	FES_MOUSE Tyrosine-protein kinase Fes/Fps OS=Mus musculus OX=10090 GN=Fes PE=1 SV=2
17	A0A8I5ZWJ2	1.70e-09	63.9	781	0.041	0.044	A0A8I5ZWJ2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1
18	E7F3T0	1.83e-09	63.2	454	0.046	0.084	E7F3T0_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=2
19	E9QCZ8	1.91e-09	63.2	449	0.046	0.085	E9QCZ8_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=1
20	D4A584	2.19e-09	63.5	822	0.041	0.041	D4A584_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Fes PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00617 RasGEF	1.1e-07	43.8	RasGEF domain
2	PF00017 SH2	2.5e-10	51.6	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359264

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391669	0.995	Breast cancer anti-estrogen resistance protein 1
2	9606.ENSP00000368759	0.989	Enhancer of filamentation 1
3	9606.ENSP00000383118	0.931	Cell division control protein 42 homolog
4	9606.ENSP00000356064	0.694	Tubby-related protein 4
5	9606.ENSP00000436785	0.693	Solute carrier family 35 member F2
6	9606.ENSP00000281830	0.676	Potassium voltage-gated channel subfamily E member 4
7	9606.ENSP00000368572	0.659	Diamine acetyltransferase 1
8	9606.ENSP00000271234	0.642	Formin-binding protein 1-like
9	9606.ENSP00000330221	0.630	SPRY domain-containing SOCS box protein 1
10	9606.ENSP00000351777	0.630	Transitional endoplasmic reticulum ATPase
11	9606.ENSP00000381333	0.624	Corticotropin-releasing factor receptor 1
12	9606.ENSP00000322594	0.609	Ras-related protein Rab-39A
13	9606.ENSP00000362680	0.559	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000264668	0.535	Methionine synthase reductase
15	9606.ENSP00000275493	0.532	Epidermal growth factor receptor
16	9606.ENSP00000383594	0.515	Transmembrane protein 242
17	9606.ENSP00000267101	0.508	Receptor tyrosine-protein kinase erbB-3
18	9606.ENSP00000380638	0.500	Protein-tyrosine kinase 2-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.701	enzyme binding
GO:0051219	0.587	phosphoprotein binding
GO:0045309	0.565	protein phosphorylated amino acid binding
GO:0001784	0.563	phosphotyrosine residue binding
GO:0019900	0.485	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0051716	0.972	cellular response to stimulus
GO:0048522	0.953	positive regulation of cellular process
GO:0023052	0.926	signaling
GO:0019222	0.925	regulation of metabolic process
GO:0007165	0.924	signal transduction
GO:0080090	0.907	regulation of primary metabolic process
GO:0051171	0.907	regulation of nitrogen compound metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0060255	0.897	regulation of macromolecule metabolic process
GO:0065009	0.835	regulation of molecular function
GO:0048583	0.826	regulation of response to stimulus
GO:0050790	0.822	regulation of catalytic activity
GO:0031325	0.816	positive regulation of cellular metabolic process
GO:0051173	0.815	positive regulation of nitrogen compound metabolic process
GO:0010604	0.807	positive regulation of macromolecule metabolic process
GO:0007166	0.768	cell surface receptor signaling pathway
GO:0043085	0.736	positive regulation of catalytic activity
GO:0009966	0.720	regulation of signal transduction
GO:0048584	0.640	positive regulation of response to stimulus
GO:0070887	0.603	cellular response to chemical stimulus
GO:0007169	0.517	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1902531	0.424	regulation of intracellular signal transduction
GO:0071310	0.415	cellular response to organic substance
GO:0009967	0.398	positive regulation of signal transduction
GO:0071495	0.375	cellular response to endogenous stimulus
GO:0032501	0.358	multicellular organismal process
GO:0032502	0.352	developmental process
GO:1902533	0.341	positive regulation of intracellular signal transduction
GO:0019219	0.315	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0030055	0.981	cell-substrate junction
GO:0005925	0.941	focal adhesion
GO:0005622	0.936	intracellular anatomical structure
GO:0005737	0.933	cytoplasm
GO:0005829	0.886	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]