StarFunc result for job id O75829

User Input

>input (334 residues)
MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIG
AFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGI
TGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVK
DNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGR
LNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL
GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75829	1.000	1.000	6.041E-62	334	1.000	1.000	O75829.pdb.gz	CNMD_HUMAN Leukocyte cell-derived chemotaxin 1 OS=Homo sapiens OX=9606 GN=CNMD PE=1 SV=1
2	AFDB:O70367	0.623	0.623	9.545E-50	334	0.892	0.892	O70367.pdb.gz	CNMD_RAT Leukocyte cell-derived chemotaxin 1 OS=Rattus norvegicus OX=10116 GN=Cnmd PE=1 SV=1
3	AFDB:Q9EP64	0.356	0.373	1.758E-24	317	0.335	0.353	Q9EP64.pdb.gz	TNMD_MOUSE Tenomodulin OS=Mus musculus OX=10090 GN=Tnmd PE=2 SV=1
4	AFDB:Q86XP6	0.360	0.616	8.703E-9	184	0.075	0.136	Q86XP6.pdb.gz	GKN2_HUMAN Gastrokine-2 OS=Homo sapiens OX=9606 GN=GKN2 PE=1 SV=2
5	AFDB:Q9NS71	0.330	0.526	2.886E-8	199	0.087	0.146	Q9NS71.pdb.gz	GKN1_HUMAN Gastrokine-1 OS=Homo sapiens OX=9606 GN=GKN1 PE=1 SV=4
6	AFDB:A0A384MDP7	0.310	0.377	5.108E-8	266	0.099	0.124	A0A384MDP7.pdb.gz	A0A384MDP7_HUMAN Integral membrane protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q9CR36	0.335	0.527	5.726E-8	201	0.093	0.154	Q9CR36.pdb.gz	GKN1_MOUSE Gastrokine-1 OS=Mus musculus OX=10090 GN=Gkn1 PE=2 SV=3
8	AFDB:Q6PL45	0.290	0.366	8.539E-8	260	0.147	0.188	Q6PL45.pdb.gz	BRID5_HUMAN BRICHOS domain-containing protein 5 OS=Homo sapiens OX=9606 GN=BRICD5 PE=1 SV=3
9	AFDB:Q9CQS6	0.347	0.586	8.539E-8	184	0.084	0.152	Q9CQS6.pdb.gz	GKN2_MOUSE Gastrokine-2 OS=Mus musculus OX=10090 GN=Gkn2 PE=1 SV=1
10	AFDB:Q9D0T7	0.296	0.477	2.254E-7	191	0.069	0.120	Q9D0T7.pdb.gz	GKN3_MOUSE Gastrokine-3 OS=Mus musculus OX=10090 GN=Gkn3 PE=1 SV=1
11	PDB:6e8nA	0.176	0.300	7.918E-3	185	0.027	0.049	6e8nA.pdb.gz
12	PDB:6jlaD	0.175	0.293	7.918E-3	188	0.036	0.064	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.
13	PDB:2w7qA	0.159	0.256	1.484E-2	192	0.036	0.062	2w7qA.pdb.gz
14	PDB:2kr0A	0.117	0.100	5.840E-2	407	0.108	0.088	2kr0A.pdb.gz
15	PDB:6xywBd	0.102	0.144	1.094E-1	216	0.075	0.116	6xywBd.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
16	PDB:7pnvD	0.084	0.083	2.299E-1	343	0.060	0.058	7pnvD.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:7l08AD	0.118	0.116	2.434E-1	343	0.081	0.079	7l08AD.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
18	PDB:4anjA	0.144	0.055	3.058E-1	995	0.051	0.017	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
19	PDB:7qe7A	0.137	0.035	3.428E-1	1648	0.081	0.016	7qe7A.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:1lqmH	0.133	0.449	4.560E-1	84	0.033	0.131	1lqmH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70367	0.0	626	334	0.892	0.892	CNMD_RAT Leukocyte cell-derived chemotaxin 1 OS=Rattus norvegicus OX=10116 GN=Cnmd PE=1 SV=1
2	O75829	0.0	697	334	1.000	1.000	CNMD_HUMAN Leukocyte cell-derived chemotaxin 1 OS=Homo sapiens OX=9606 GN=CNMD PE=1 SV=1
3	Q9Z1F6	0.0	625	334	0.889	0.889	CNMD_MOUSE Leukocyte cell-derived chemotaxin 1 OS=Mus musculus OX=10090 GN=Cnmd PE=1 SV=2
4	Q9ESC2	1.15e-60	198	317	0.335	0.353	TNMD_RAT Tenomodulin OS=Rattus norvegicus OX=10116 GN=Tnmd PE=1 SV=1
5	Q9EP64	2.46e-60	197	317	0.332	0.350	TNMD_MOUSE Tenomodulin OS=Mus musculus OX=10090 GN=Tnmd PE=2 SV=1
6	Q9H2S6	6.65e-59	194	317	0.332	0.350	TNMD_HUMAN Tenomodulin OS=Homo sapiens OX=9606 GN=TNMD PE=1 SV=1
7	P21841	6.51e-06	48.5	193	0.093	0.161	PSPC_MOUSE Pulmonary surfactant-associated protein C OS=Mus musculus OX=10090 GN=Sftpc PE=1 SV=1
8	P11685	4.90e-05	45.8	194	0.087	0.149	PSPC_RAT Pulmonary surfactant-associated protein C OS=Rattus norvegicus OX=10116 GN=Sftpc PE=2 SV=1
9	P11686	0.16	35.4	197	0.078	0.132	PSPC_HUMAN Pulmonary surfactant-associated protein C OS=Homo sapiens OX=9606 GN=SFTPC PE=1 SV=2
10	Q9CQS6	0.17	35.0	184	0.102	0.185	GKN2_MOUSE Gastrokine-2 OS=Mus musculus OX=10090 GN=Gkn2 PE=1 SV=1
11	Q86XP6	1.3	32.7	184	0.096	0.174	GKN2_HUMAN Gastrokine-2 OS=Homo sapiens OX=9606 GN=GKN2 PE=1 SV=2
12	A0A0G2K715	4.8	31.6	2479	0.099	0.013	A0A0G2K715_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
13	A0A0G2K929	4.8	31.6	2756	0.099	0.012	A0A0G2K929_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
14	A0A8I5ZYJ8	4.8	31.6	2503	0.099	0.013	A0A8I5ZYJ8_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
15	Q5QNQ6	5.7	31.6	908	0.057	0.021	OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1
16	Q09289	6.2	31.2	374	0.048	0.043	ADRM1_CAEEL Proteasomal ubiquitin receptor ADRM1 homolog OS=Caenorhabditis elegans OX=6239 GN=rpn-13 PE=1 SV=2
17	Q969R2	6.7	31.2	916	0.057	0.021	OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04089 BRICHOS	6.6e-17	72.9	BRICHOS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274507	0.775	Leukocyte cell-derived chemotaxin-2
2	9606.ENSP00000341640	0.736	Collagen alpha-3(IX) chain
3	9606.ENSP00000361834	0.718	Collagen alpha-2(IX) chain
4	9606.ENSP00000223500	0.574	Charged multivesicular body protein 5
5	9606.ENSP00000380998	0.536	Charged multivesicular body protein 1a
6	9606.ENSP00000238497	0.535	Vacuolar protein sorting-associated protein 4B
7	9606.ENSP00000254950	0.535	Vacuolar protein sorting-associated protein 4A
8	9606.ENSP00000369889	0.517	Collagen alpha-1(II) chain
9	9606.ENSP00000217402	0.506	Charged multivesicular body protein 4b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048519	0.990	negative regulation of biological process
GO:0009987	0.984	cellular process
GO:0045765	0.980	regulation of angiogenesis
GO:2000181	0.978	negative regulation of blood vessel morphogenesis
GO:0016525	0.957	negative regulation of angiogenesis
GO:0050794	0.891	regulation of cellular process
GO:0048856	0.826	anatomical structure development
GO:0048523	0.683	negative regulation of cellular process
GO:0032501	0.654	multicellular organismal process
GO:0071704	0.636	organic substance metabolic process
GO:0044238	0.627	primary metabolic process
GO:0044237	0.588	cellular metabolic process
GO:0006807	0.578	nitrogen compound metabolic process
GO:0043170	0.521	macromolecule metabolic process
GO:0007275	0.509	multicellular organism development
GO:1901564	0.508	organonitrogen compound metabolic process
GO:0019538	0.492	protein metabolic process
GO:0048731	0.460	system development
GO:0050896	0.348	response to stimulus
GO:0042127	0.300	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0031982	0.936	vesicle
GO:0005615	0.932	extracellular space
GO:0097708	0.911	intracellular vesicle
GO:0031410	0.903	cytoplasmic vesicle
GO:0070013	0.873	intracellular organelle lumen
GO:0016020	0.744	membrane
GO:0005768	0.711	endosome
GO:0005770	0.564	late endosome
GO:0071944	0.560	cell periphery
GO:0005634	0.558	nucleus
GO:0005886	0.530	plasma membrane
GO:0099503	0.528	secretory vesicle
GO:0030141	0.485	secretory granule
GO:0005794	0.379	Golgi apparatus
GO:1903561	0.375	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]