StarFunc result for job id O75832

User Input

>input (226 residues)
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z2X2	0.965	0.944	5.101E-29	231	0.938	0.918	Q9Z2X2.pdb.gz	PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus OX=10090 GN=Psmd10 PE=1 SV=3
2	PDB:2dvwA	0.953	0.940	7.312E-27	229	0.912	0.900	2dvwA.pdb.gz
3	AFDB:Q4VBW1	0.955	0.955	2.377E-24	226	0.699	0.699	Q4VBW1.pdb.gz
4	AFDB:Q8GZ22	0.894	0.844	1.540E-15	240	0.367	0.346	Q8GZ22.pdb.gz	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
5	AFDB:Q9VBP3	0.482	0.093	1.105E-14	1181	0.327	0.063	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
6	AFDB:Q9H9B1	0.885	0.161	1.085E-13	1298	0.283	0.049	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
7	AFDB:P50086	0.886	0.879	1.135E-13	228	0.323	0.320	P50086.pdb.gz	PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAS6 PE=1 SV=1
8	AFDB:Q80YE7	0.870	0.144	1.358E-13	1442	0.257	0.040	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
9	AFDB:A2ABF9	0.905	0.167	2.222E-13	1267	0.283	0.051	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
10	AFDB:Q54KA7	0.880	0.211	2.430E-13	986	0.305	0.070	Q54KA7.pdb.gz	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
11	AFDB:G5E8K5	0.900	0.107	2.658E-13	1961	0.319	0.037	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
12	PDB:1wg0A	0.876	0.818	3.952E-13	243	0.323	0.300	1wg0A.pdb.gz
13	PDB:8cs9A	0.628	0.220	1.449E-12	796	0.332	0.094	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:6v9hC	0.852	0.719	8.760E-10	270	0.265	0.222	6v9hC.pdb.gz
15	PDB:4oauC	0.798	0.284	7.520E-9	692	0.279	0.091	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:6jd6B	0.614	0.716	7.864E-9	192	0.239	0.281	6jd6B.pdb.gz
17	PDB:6aunA	0.546	0.250	1.684E-8	618	0.265	0.097	6aunA.pdb.gz
18	PDB:5vkqA	0.613	0.124	1.842E-8	1499	0.305	0.046	5vkqA.pdb.gz
19	PDB:6mwqA	0.640	0.300	9.236E-8	493	0.261	0.120	6mwqA.pdb.gz
20	PDB:6pqpA	0.711	0.276	2.262E-7	615	0.190	0.070	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75832	1.89e-168	464	226	1.000	1.000	PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10 PE=1 SV=1
2	Q9Z2X2	1.90e-160	444	231	0.938	0.918	PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus OX=10090 GN=Psmd10 PE=1 SV=3
3	Q6TGV5	9.38e-120	341	226	0.721	0.721	Q6TGV5_DANRE 26S proteasome non-ATPase regulatory subunit 10 OS=Danio rerio OX=7955 GN=PSMD10 PE=1 SV=1
4	Q8GZ22	5.22e-37	131	240	0.363	0.342	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
5	P50086	1.36e-30	114	228	0.332	0.329	PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAS6 PE=1 SV=1
6	Q12955	2.51e-30	120	4377	0.305	0.016	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
7	G5E8K5	1.59e-29	117	1961	0.305	0.035	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
8	O70511	1.95e-29	117	2622	0.305	0.026	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
9	O88521	1.70e-28	115	1762	0.305	0.039	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
10	A0A5F9ZGX3	1.00e-27	112	3972	0.279	0.016	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZH19	1.00e-27	112	3895	0.279	0.016	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZHD2	1.00e-27	112	3936	0.279	0.016	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZHE4	1.00e-27	112	3964	0.279	0.016	A0A5F9ZHE4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZHN5	1.00e-27	112	3903	0.279	0.016	A0A5F9ZHN5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZHS1	1.00e-27	112	3984	0.279	0.016	A0A5F9ZHS1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZI30	1.00e-27	112	3820	0.279	0.016	A0A5F9ZI30_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZI40	1.00e-27	112	3915	0.279	0.016	A0A5F9ZI40_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	D6RHE1	1.00e-27	112	3961	0.279	0.016	D6RHE1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=2
19	Q01484	1.00e-27	112	3957	0.279	0.016	ANK2_HUMAN Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4
20	A0A5F9ZGY3	1.02e-27	112	3934	0.279	0.016	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	8.2e-35	129.0	Ankyrin repeat
2	PF12796 Ank_2	5.3e-48	172.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.4e-33	121.2	Ankyrin repeat
4	PF13637 Ank_4	2.5e-45	163.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.2e-32	121.1	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000003387

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000004673	0.990	Proteasome (prosome, macropain) 26S subunit, ATPase, 2
2	43179.ENSSTOP00000008014	0.989	Uncharacterized protein
3	43179.ENSSTOP00000011204	0.989	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
4	43179.ENSSTOP00000022885	0.988	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
5	43179.ENSSTOP00000000551	0.987	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
6	43179.ENSSTOP00000007390	0.985	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
7	43179.ENSSTOP00000013495	0.980	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
8	43179.ENSSTOP00000011762	0.979	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
9	43179.ENSSTOP00000001484	0.977	Uncharacterized protein
10	43179.ENSSTOP00000023170	0.976	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
11	43179.ENSSTOP00000003284	0.975	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
12	43179.ENSSTOP00000008694	0.975	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
13	43179.ENSSTOP00000012983	0.970	26S proteasome regulatory subunit 10B
14	43179.ENSSTOP00000009605	0.969	Proteasomal ATPase-associated factor 1
15	43179.ENSSTOP00000000834	0.966	RB transcriptional corepressor 1
16	43179.ENSSTOP00000011269	0.959	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
17	43179.ENSSTOP00000008396	0.956	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
18	43179.ENSSTOP00000013340	0.937	Proteasome 26S subunit, non-ATPase 14
19	43179.ENSSTOP00000019929	0.937	Uncharacterized protein
20	43179.ENSSTOP00000002412	0.919	Adhesion regulating molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0043067	0.975	regulation of programmed cell death
GO:0009987	0.973	cellular process
GO:0042981	0.973	regulation of apoptotic process
GO:0019222	0.962	regulation of metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0048518	0.923	positive regulation of biological process
GO:0031323	0.920	regulation of cellular metabolic process
GO:0061136	0.919	regulation of proteasomal protein catabolic process
GO:0048522	0.903	positive regulation of cellular process
GO:0032434	0.896	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1901796	0.892	regulation of signal transduction by p53 class mediator
GO:1903052	0.875	positive regulation of proteolysis involved in protein catabolic process
GO:0065009	0.849	regulation of molecular function
GO:1903320	0.843	regulation of protein modification by small protein conjugation or removal
GO:0048519	0.832	negative regulation of biological process
GO:1901800	0.831	positive regulation of proteasomal protein catabolic process
GO:2001020	0.826	regulation of response to DNA damage stimulus
GO:0048523	0.809	negative regulation of cellular process
GO:0031325	0.793	positive regulation of cellular metabolic process
GO:1903322	0.792	positive regulation of protein modification by small protein conjugation or removal
GO:2000060	0.730	positive regulation of ubiquitin-dependent protein catabolic process
GO:0032436	0.715	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0010821	0.706	regulation of mitochondrion organization
GO:0031398	0.702	positive regulation of protein ubiquitination
GO:0010468	0.672	regulation of gene expression
GO:0051252	0.668	regulation of RNA metabolic process
GO:0010556	0.661	regulation of macromolecule biosynthetic process
GO:0031326	0.661	regulation of cellular biosynthetic process
GO:0043516	0.645	regulation of DNA damage response, signal transduction by p53 class mediator
GO:2001233	0.586	regulation of apoptotic signaling pathway
GO:0090199	0.571	regulation of release of cytochrome c from mitochondria
GO:0006355	0.491	regulation of DNA-templated transcription
GO:0060548	0.490	negative regulation of cell death
GO:0008152	0.460	metabolic process
GO:0010823	0.445	negative regulation of mitochondrion organization
GO:0048585	0.441	negative regulation of response to stimulus
GO:0071704	0.428	organic substance metabolic process
GO:0023057	0.419	negative regulation of signaling
GO:0010648	0.419	negative regulation of cell communication
GO:0009968	0.409	negative regulation of signal transduction
GO:0044238	0.381	primary metabolic process
GO:0006807	0.376	nitrogen compound metabolic process
GO:0050896	0.363	response to stimulus
GO:0051090	0.352	regulation of DNA-binding transcription factor activity
GO:0043170	0.332	macromolecule metabolic process
GO:1901564	0.307	organonitrogen compound metabolic process
GO:0009892	0.303	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.991	cytosol
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0000502	0.966	proteasome complex
GO:0008540	0.639	proteasome regulatory particle, base subcomplex
GO:0005856	0.481	cytoskeleton
GO:0016020	0.433	membrane
GO:0045111	0.306	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]