StarFunc result for job id O75840

User Input

>input (302 residues)
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3X8	0.373	0.373	1.263E-39	302	1.000	1.000	A0A024R3X8.pdb.gz
2	AFDB:Q5TYN4	0.347	0.355	7.204E-22	295	0.616	0.631	Q5TYN4.pdb.gz	Q5TYN4_DANRE Klf7l protein OS=Danio rerio OX=7955 GN=klf7l PE=2 SV=1
3	AFDB:F1R7F0	0.311	0.331	1.315E-17	283	0.493	0.527	F1R7F0.pdb.gz	F1R7F0_DANRE Krueppel-like factor 6 OS=Danio rerio OX=7955 GN=cb538 PE=4 SV=1
4	AFDB:O08584	0.321	0.340	1.779E-16	283	0.474	0.505	O08584.pdb.gz	KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus OX=10090 GN=Klf6 PE=2 SV=3
5	AFDB:P57682	0.292	0.257	9.113E-14	345	0.248	0.217	P57682.pdb.gz	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
6	AFDB:A0A024R9X4	0.285	0.240	2.711E-13	359	0.228	0.192	A0A024R9X4.pdb.gz
7	AFDB:O35738	0.291	0.219	4.143E-13	402	0.262	0.197	O35738.pdb.gz	KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus OX=10090 GN=Klf12 PE=1 SV=2
8	AFDB:Q9TZ64	0.293	0.179	6.330E-13	497	0.262	0.159	Q9TZ64.pdb.gz	KLF1_CAEEL Kruppel-like factor 1 OS=Caenorhabditis elegans OX=6239 GN=klf-1 PE=1 SV=1
9	AFDB:A0S0R1	0.285	0.251	7.146E-13	343	0.242	0.213	A0S0R1.pdb.gz	A0S0R1_DANRE Krueppel-like factor 8 OS=Danio rerio OX=7955 GN=si:ch211-208m1.2 PE=2 SV=1
10	AFDB:A2BG67	0.291	0.269	7.146E-13	328	0.265	0.244	A2BG67.pdb.gz	A2BG67_DANRE Krueppel-like factor 3 OS=Danio rerio OX=7955 GN=klf12 PE=4 SV=1
11	PDB:7lbmh	0.156	0.258	2.111	158	0.070	0.133	7lbmh.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
12	PDB:7emfD	0.141	0.256	3.226	158	0.063	0.120	7emfD.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:5n9jE	0.109	0.152	4.367	201	0.070	0.104	5n9jE.pdb.gz
14	PDB:7vopc	0.098	0.140	4.930	198	0.106	0.162	7vopc.pdb.gz
15	PDB:7qp7y	0.161	0.083	5.237	642	0.060	0.028	7qp7y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
16	PDB:7rroA0	0.120	0.157	5.237	221	0.073	0.100	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:4h63H	0.120	0.177	5.564	174	0.063	0.109	4h63H.pdb.gz
18	PDB:6cozA	0.061	0.105	5.564	160	0.023	0.044	6cozA.pdb.gz
19	PDB:6k15J	0.093	0.109	5.564	235	0.099	0.128	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:7r5jD4	0.149	0.056	5.564	1312	0.086	0.020	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75840	0.0	624	302	1.000	1.000	KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens OX=9606 GN=KLF7 PE=1 SV=1
2	Q99JB0	0.0	602	301	0.970	0.973	KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus OX=10090 GN=Klf7 PE=1 SV=1
3	Q5TYN4	1.31e-133	382	295	0.659	0.675	Q5TYN4_DANRE Klf7l protein OS=Danio rerio OX=7955 GN=klf7l PE=2 SV=1
4	C9JX20	1.86e-115	332	175	0.563	0.971	C9JX20_HUMAN Kruppel like factor 7 OS=Homo sapiens OX=9606 GN=KLF7 PE=1 SV=1
5	O08584	3.14e-89	269	283	0.520	0.555	KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus OX=10090 GN=Klf6 PE=2 SV=3
6	O35819	8.36e-89	268	283	0.523	0.558	KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus OX=10116 GN=Klf6 PE=2 SV=2
7	Q99612	9.79e-88	265	283	0.517	0.551	KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens OX=9606 GN=KLF6 PE=1 SV=3
8	F1R7F0	1.43e-69	219	283	0.447	0.477	F1R7F0_DANRE Krueppel-like factor 6 OS=Danio rerio OX=7955 GN=cb538 PE=4 SV=1
9	Q8MR37	1.43e-56	193	570	0.268	0.142	KLFL_DROME Krueppel-like factor luna OS=Drosophila melanogaster OX=7227 GN=luna PE=2 SV=1
10	D4A4V3	5.58e-51	173	344	0.232	0.203	D4A4V3_RAT Kruppel like factor 3 OS=Rattus norvegicus OX=10116 GN=Klf3 PE=1 SV=1
11	Q60980	6.55e-51	173	344	0.232	0.203	KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus OX=10090 GN=Klf3 PE=1 SV=1
12	P57682	6.79e-51	173	345	0.232	0.203	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
13	A2BG67	6.91e-51	172	328	0.242	0.223	A2BG67_DANRE Krueppel-like factor 3 OS=Danio rerio OX=7955 GN=klf12 PE=4 SV=1
14	O35738	1.21e-50	174	402	0.242	0.182	KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus OX=10090 GN=Klf12 PE=1 SV=2
15	Q9Y4X4	1.58e-50	173	402	0.242	0.182	KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens OX=9606 GN=KLF12 PE=1 SV=2
16	Q9Z0Z7	1.83e-50	174	446	0.242	0.164	KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus OX=10090 GN=Klf5 PE=1 SV=2
17	Q66HP1	3.52e-50	171	363	0.238	0.198	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
18	A0S0R1	8.53e-50	170	343	0.242	0.213	A0S0R1_DANRE Krueppel-like factor 8 OS=Danio rerio OX=7955 GN=si:ch211-208m1.2 PE=2 SV=1
19	F1LSL7	8.53e-50	172	443	0.238	0.163	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2
20	Q13887	9.77e-50	172	457	0.238	0.158	KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.9e-10	51.7	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	0.0018	29.9	C2H2-type zinc finger
3	PF13465 zf-H2C2_2	1.2e-05	36.7	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384376.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010364046.1	0.852	Jun proto-oncogene, AP-1 transcription factor subunit
2	61622.XP_010364402.1	0.820	Cyclic AMP-dependent transcription factor ATF-3 isoform X1
3	61622.XP_010377114.1	0.794	Protein BTG2
4	61622.XP_010354647.1	0.717	Homeobox protein BarH-like 2
5	61622.XP_010385132.1	0.717	F-box only protein 38 isoform X1
6	61622.XP_010368968.1	0.667	Nuclear factor 1 A-type isoform X1
7	61622.XP_010384364.1	0.575	Pleckstrin homology domain-containing family M member 3 isoform X1
8	61622.XP_010372223.1	0.572	Sp1 transcription factor
9	61622.XP_010371503.1	0.501	Lymphoid enhancer-binding factor 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0043565	0.993	sequence-specific DNA binding
GO:0003690	0.985	double-stranded DNA binding
GO:0000976	0.982	transcription cis-regulatory region binding
GO:0000981	0.948	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.900	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.876	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.832	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.389	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0009987	0.978	cellular process
GO:0080090	0.948	regulation of primary metabolic process
GO:0010468	0.945	regulation of gene expression
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0031323	0.935	regulation of cellular metabolic process
GO:0010556	0.931	regulation of macromolecule biosynthetic process
GO:0031326	0.931	regulation of cellular biosynthetic process
GO:0006355	0.920	regulation of DNA-templated transcription
GO:0051173	0.886	positive regulation of nitrogen compound metabolic process
GO:0031325	0.886	positive regulation of cellular metabolic process
GO:0051254	0.877	positive regulation of RNA metabolic process
GO:0045893	0.867	positive regulation of DNA-templated transcription
GO:0006357	0.862	regulation of transcription by RNA polymerase II
GO:0048519	0.846	negative regulation of biological process
GO:0045944	0.768	positive regulation of transcription by RNA polymerase II
GO:0032502	0.754	developmental process
GO:0032501	0.735	multicellular organismal process
GO:0048523	0.730	negative regulation of cellular process
GO:0048856	0.720	anatomical structure development
GO:0050896	0.633	response to stimulus
GO:0007275	0.593	multicellular organism development
GO:0010605	0.593	negative regulation of macromolecule metabolic process
GO:0051172	0.463	negative regulation of nitrogen compound metabolic process
GO:0048583	0.449	regulation of response to stimulus
GO:0010558	0.445	negative regulation of macromolecule biosynthetic process
GO:0031327	0.445	negative regulation of cellular biosynthetic process
GO:0045892	0.395	negative regulation of DNA-templated transcription
GO:0000122	0.365	negative regulation of transcription by RNA polymerase II
GO:0051716	0.350	cellular response to stimulus
GO:0048731	0.349	system development
GO:0048869	0.328	cellular developmental process
GO:0030154	0.324	cell differentiation
GO:0051239	0.312	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]