StarFunc result for job id O75880

User Input

>input (301 residues)
MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGY
CLGTRPLSTARPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKA
EKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKM
IQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARA
YRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKK
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75880	1.000	1.000	5.850E-56	301	1.000	1.000	O75880.pdb.gz	SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1
2	AFDB:Q5SUC9	0.593	0.627	1.229E-41	284	0.701	0.743	Q5SUC9.pdb.gz	SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1
3	AFDB:Q9VMX4	0.660	0.782	6.785E-33	251	0.415	0.498	Q9VMX4.pdb.gz	Q9VMX4_DROME AT19154p OS=Drosophila melanogaster OX=7227 GN=Scox PE=1 SV=1
4	AFDB:Q8VCL2	0.587	0.687	5.590E-28	255	0.329	0.388	Q8VCL2.pdb.gz	SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1
5	AFDB:O43819	0.593	0.665	6.716E-28	266	0.336	0.380	O43819.pdb.gz	SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3
6	AFDB:Q8VYP0	0.544	0.492	7.590E-28	334	0.349	0.314	Q8VYP0.pdb.gz	SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC1 PE=1 SV=1
7	AFDB:O42899	0.617	0.700	2.066E-26	263	0.316	0.361	O42899.pdb.gz	SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sco1 PE=3 SV=1
8	AFDB:A0A1D8PTX2	0.548	0.548	3.242E-25	301	0.302	0.302	A0A1D8PTX2.pdb.gz	A0A1D8PTX2_CANAL Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCO1 PE=3 SV=1
9	AFDB:P38072	0.516	0.516	5.978E-25	301	0.299	0.299	P38072.pdb.gz	SCO2_YEAST Protein SCO2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO2 PE=1 SV=1
10	AFDB:Q38FS2	0.585	0.549	2.297E-24	323	0.322	0.300	Q38FS2.pdb.gz	Q38FS2_TRYB2 Electon transport protein SCO1/SCO2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1140 PE=3 SV=1
11	PDB:3iosA	0.358	0.732	3.009E-7	134	0.083	0.187	3iosA.pdb.gz
12	PDB:5b6mF	0.382	0.495	3.400E-7	223	0.096	0.130	5b6mF.pdb.gz
13	PDB:4k1fA	0.305	0.436	2.131E-6	198	0.090	0.136	4k1fA.pdb.gz
14	PDB:2r37A	0.354	0.525	2.409E-6	191	0.096	0.152	2r37A.pdb.gz
15	PDB:2f8aA	0.344	0.521	3.271E-6	186	0.100	0.161	2f8aA.pdb.gz
16	PDB:2i3yA	0.351	0.527	3.477E-6	188	0.086	0.138	2i3yA.pdb.gz
17	PDB:4af2A	0.383	0.626	5.020E-6	175	0.076	0.131	4af2A.pdb.gz
18	PDB:2z9sA	0.353	0.508	5.673E-6	197	0.076	0.117	2z9sA.pdb.gz
19	PDB:2bmxB	0.371	0.591	7.246E-6	178	0.090	0.152	2bmxB.pdb.gz
20	PDB:2p31A	0.351	0.629	7.246E-6	155	0.080	0.155	2p31A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75880	0.0	618	301	1.000	1.000	SCO1_HUMAN Protein SCO1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO1 PE=1 SV=1
2	Q5SUC9	3.67e-130	373	284	0.694	0.736	SCO1_MOUSE Protein SCO1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco1 PE=1 SV=1
3	Q9VMX4	4.41e-89	268	251	0.409	0.490	Q9VMX4_DROME AT19154p OS=Drosophila melanogaster OX=7227 GN=Scox PE=1 SV=1
4	Q8VCL2	1.10e-65	208	255	0.332	0.392	SCO2_MOUSE Protein SCO2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Sco2 PE=1 SV=1
5	O43819	2.62e-64	205	266	0.306	0.346	SCO2_HUMAN Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3
6	Q8VYP0	1.55e-62	202	334	0.326	0.293	SCO11_ARATH Protein SCO1 homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC1 PE=1 SV=1
7	O42899	3.44e-54	179	263	0.282	0.323	SCO1_SCHPO Protein sco1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sco1 PE=3 SV=1
8	Q38FS2	1.60e-49	169	323	0.266	0.248	Q38FS2_TRYB2 Electon transport protein SCO1/SCO2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1140 PE=3 SV=1
9	P23833	3.15e-48	164	295	0.269	0.275	SCO1_YEAST Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO1 PE=1 SV=1
10	P38072	6.69e-46	159	301	0.282	0.282	SCO2_YEAST Protein SCO2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCO2 PE=1 SV=1
11	Q38EA7	2.75e-45	156	271	0.229	0.255	Q38EA7_TRYB2 Cytochrome c oxidase assembly factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0510 PE=3 SV=1
12	A0A1D8PTX2	4.11e-43	151	301	0.262	0.262	A0A1D8PTX2_CANAL Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SCO1 PE=3 SV=1
13	Q8LAL0	9.23e-35	129	276	0.203	0.221	SCO12_ARATH Protein SCO1 homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HCC2 PE=2 SV=1
14	Q89VB6	3.46e-34	125	196	0.213	0.327	Q89VB6_BRADU Blr1131 protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=blr1131 PE=1 SV=1
15	Q52720	8.21e-32	119	221	0.203	0.276	SENC_RHOCB Protein SenC OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) OX=272942 GN=senC PE=3 SV=2
16	Q4GZ61	9.52e-29	114	301	0.209	0.209	Q4GZ61_TRYB2 Cytochrome c oxidase assembly factor, putative electron transport protein SCO1/2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1580 PE=3 SV=1
17	A0A1W2PQK0	4.27e-21	90.1	168	0.140	0.250	A0A1W2PQK0_HUMAN Synthesis of cytochrome C oxidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=2
18	Q2GJ45	2.18e-20	89.4	209	0.173	0.249	Q2GJ45_ANAPZ Major surface protein 5 OS=Anaplasma phagocytophilum (strain HZ) OX=212042 GN=msp5 PE=3 SV=1
19	Q96VT4	0.23	35.4	739	0.080	0.032	KATG_EMENI Catalase-peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=katG PE=1 SV=1
20	P60723	1.1	32.7	201	0.066	0.100	RL4_ECOLI Large ribosomal subunit protein uL4 OS=Escherichia coli (strain K12) OX=83333 GN=rplD PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	0.0019	29.5	AhpC/TSA family
2	PF02630 SCO1-SenC	1.3e-44	162.9	SCO1/SenC
3	PF07517 SecA_DEAD	2.5e+02	12.3	SecA DEAD-like domain
4	PF13905 Thioredoxin_8	43	15.8	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261070	0.998	Cytochrome c oxidase copper chaperone
2	9606.ENSP00000299335	0.970	Cytochrome c oxidase assembly protein COX11, mitochondrial
3	9606.ENSP00000016171	0.960	Cytochrome c oxidase assembly protein COX15 homolog
4	9606.ENSP00000354876	0.955	Cytochrome c oxidase subunit 2
5	9606.ENSP00000307786	0.946	Cytochrome c
6	9606.ENSP00000342015	0.939	Cytochrome c oxidase assembly protein COX19
7	9606.ENSP00000355572	0.938	Cytochrome c oxidase assembly factor 6 homolog
8	9606.ENSP00000361042	0.937	Surfeit locus protein 1
9	9606.ENSP00000261643	0.917	Protoheme IX farnesyltransferase, mitochondrial
10	9606.ENSP00000354499	0.867	Cytochrome c oxidase subunit 1
11	9606.ENSP00000406327	0.866	Cytochrome c oxidase protein 20 homolog
12	9606.ENSP00000233627	0.864	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
13	9606.ENSP00000246554	0.841	Cytochrome c oxidase subunit 6B1
14	9606.ENSP00000430598	0.809	Copper transport protein ATOX1
15	9606.ENSP00000317780	0.801	Cytochrome c oxidase subunit 5A, mitochondrial
16	9606.ENSP00000425261	0.796	Mitochondrial inner membrane protein COX18
17	9606.ENSP00000306397	0.768	Cytochrome b-c1 complex subunit Rieske, mitochondrial
18	9606.ENSP00000295767	0.762	Mitochondrial intermembrane space import and assembly protein 40
19	9606.ENSP00000330730	0.753	Cytochrome c oxidase assembly factor 5
20	9606.ENSP00000258975	0.748	Translational activator of cytochrome c oxidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.931	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007005	0.995	mitochondrion organization
GO:0033617	0.987	mitochondrial cytochrome c oxidase assembly
GO:0008152	0.542	metabolic process
GO:0044237	0.394	cellular metabolic process
GO:0071704	0.324	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.983	membrane
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0031090	0.907	organelle membrane
GO:0031967	0.855	organelle envelope
GO:0005740	0.853	mitochondrial envelope
GO:0031966	0.828	mitochondrial membrane
GO:0005743	0.821	mitochondrial inner membrane
GO:0032991	0.772	protein-containing complex
GO:0070013	0.436	intracellular organelle lumen
GO:0099080	0.392	supramolecular complex
GO:0099512	0.316	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]