StarFunc result for job id O75882

User Input

>input (1429 residues)
MVAAAAATEARLRRRTAATAALAGRSGGPHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPR
LLLLLLLLSPPLLLLLLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVC
PAGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATE
CSWDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTG
FNITYSFDMCPNNCSGRGECKISNSSDTVECECSENWKGEACDIPHCTDNCGFPHRGICN
SSDVRGCSCFSDWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYM
FNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNE
LRVFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEY
DLDKNTWSILHTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYDVD
TQMWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRW
SVLPRPDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDAHRSEAACLAA
GPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDC
HWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQEC
IALPENICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLR
IMQSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPS
TRGLKAATCINPLNGSVCERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVD
SNAYVASFPFGQCMEWYTMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGS
YKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKC
ENLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLC
EVENRYQGNPLRGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINAS
KNFNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNF
TWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREM
QQMASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLG
GIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q662	0.830	0.855	0.000	1386	0.689	0.711	A0A2R8Q662.pdb.gz
2	AFDB:Q6A051	0.730	0.755	0.000	1378	0.579	0.600	Q6A051.pdb.gz	ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus OX=10090 GN=Atrnl1 PE=1 SV=2
3	AFDB:Q99J86	0.827	0.825	0.000	1432	0.924	0.922	Q99J86.pdb.gz	ATRN_RAT Attractin OS=Rattus norvegicus OX=10116 GN=Atrn PE=2 SV=1
4	PDB:5gq0A	0.191	0.729	3.316E-17	338	0.043	0.180	5gq0A.pdb.gz
5	PDB:5gqtA	0.187	0.528	3.316E-17	470	0.052	0.157	5gqtA.pdb.gz
6	PDB:2zwaB	0.190	0.382	5.634E-13	683	0.038	0.081	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
7	PDB:2uvkB	0.183	0.697	1.168E-12	349	0.038	0.155	2uvkB.pdb.gz
8	AFDB:Q6P3S6	0.155	0.299	1.343E-11	717	0.038	0.075	Q6P3S6.pdb.gz	FBX42_HUMAN F-box only protein 42 OS=Homo sapiens OX=9606 GN=FBXO42 PE=1 SV=1
9	PDB:6dbjD	0.180	0.629	8.812E-11	352	0.033	0.134	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
10	PDB:6oemB	0.181	0.652	2.136E-10	346	0.034	0.142	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
11	AFDB:Q96G42	0.140	0.320	1.520E-8	594	0.034	0.082	Q96G42.pdb.gz	KLD7B_HUMAN Kelch domain-containing protein 7B OS=Homo sapiens OX=9606 GN=KLHDC7B PE=1 SV=2
12	AFDB:Q9VYC7	0.073	0.147	2.189E-8	677	0.034	0.072	Q9VYC7.pdb.gz	Q9VYC7_DROME GH11189p OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=2
13	AFDB:Q4V9Z5	0.090	0.134	2.559E-8	910	0.043	0.068	Q4V9Z5.pdb.gz	SE6L2_MOUSE Seizure 6-like protein 2 OS=Mus musculus OX=10090 GN=Sez6l2 PE=1 SV=1
14	PDB:1qddA	0.087	0.757	7.299E-8	144	0.024	0.243	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
15	PDB:7wz8A	0.081	0.595	1.864E-7	180	0.025	0.200	7wz8A.pdb.gz
16	AFDB:Q5KU26	0.087	0.165	3.646E-7	742	0.022	0.042	Q5KU26.pdb.gz	COL12_HUMAN Collectin-12 OS=Homo sapiens OX=9606 GN=COLEC12 PE=1 SV=3
17	PDB:5f2qB	0.084	0.782	1.095E-6	135	0.022	0.230	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
18	PDB:4mthA	0.082	0.742	1.662E-6	139	0.022	0.223	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
19	AFDB:Q96GW7	0.090	0.136	3.085E-6	911	0.026	0.041	Q96GW7.pdb.gz	PGCB_HUMAN Brevican core protein OS=Homo sapiens OX=9606 GN=BCAN PE=1 SV=2
20	AFDB:Q86YC2	0.140	0.162	6.739E-6	1186	0.056	0.067	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JI13	0.0	2051	1345	0.673	0.715	B8JI13_DANRE Attractin OS=Danio rerio OX=7955 GN=si:dkey-259n11.1 PE=1 SV=1
2	O75882	0.0	2989	1429	1.000	1.000	ATRN_HUMAN Attractin OS=Homo sapiens OX=9606 GN=ATRN PE=1 SV=2
3	Q6A051	0.0	1683	1378	0.574	0.595	ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus OX=10090 GN=Atrnl1 PE=1 SV=2
4	Q99J86	0.0	2699	1432	0.925	0.923	ATRN_RAT Attractin OS=Rattus norvegicus OX=10116 GN=Atrn PE=2 SV=1
5	Q9WU60	0.0	2712	1428	0.927	0.928	ATRN_MOUSE Attractin OS=Mus musculus OX=10090 GN=Atrn PE=1 SV=3
6	Q9VB20	1.67e-132	444	1323	0.188	0.203	Q9VB20_DROME Distracted, isoform B OS=Drosophila melanogaster OX=7227 GN=dsd PE=4 SV=2
7	Q960R8	3.31e-121	411	1232	0.176	0.204	Q960R8_DROME LD38671p OS=Drosophila melanogaster OX=7227 GN=dsd PE=2 SV=1
8	F1QBZ9	7.05e-60	230	2870	0.108	0.054	F1QBZ9_DANRE Multiple EGF-like-domains 8 OS=Danio rerio OX=7955 GN=megf8 PE=4 SV=2
9	Q7Z7M0	3.89e-54	211	2845	0.111	0.056	MEGF8_HUMAN Multiple epidermal growth factor-like domains protein 8 OS=Homo sapiens OX=9606 GN=MEGF8 PE=1 SV=2
10	P60882	5.20e-51	201	2789	0.108	0.056	MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus OX=10090 GN=Megf8 PE=1 SV=2
11	F1M798	7.49e-12	72.8	990	0.034	0.049	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
12	P98063	8.37e-12	72.8	991	0.034	0.049	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
13	Q9V410	1.44e-11	72.0	975	0.051	0.075	LZTR1_DROME Leucine-zipper-like transcriptional regulator 1 homolog OS=Drosophila melanogaster OX=7227 GN=Lztr1 PE=1 SV=1
14	P13497	1.73e-11	71.6	986	0.034	0.049	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
15	Q9VTP0	2.18e-11	71.6	3613	0.034	0.014	Q9VTP0_DROME Cubulin 2 OS=Drosophila melanogaster OX=7227 GN=Cubn2 PE=4 SV=4
16	P50090	2.60e-11	70.9	882	0.062	0.100	KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KEL2 PE=1 SV=1
17	Q9MA55	5.93e-11	69.7	668	0.055	0.118	ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1
18	Q8VEM9	8.17e-11	68.2	382	0.042	0.157	KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus OX=10090 GN=Klhdc3 PE=2 SV=1
19	Q54C94	1.10e-10	68.9	1127	0.043	0.054	GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum OX=44689 GN=gefF PE=2 SV=1
20	Q62381	1.31e-10	68.9	1013	0.033	0.046	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	7e-10	50.6	CUB domain
2	PF00008 EGF	24	16.6	EGF-like domain
3	PF07974 EGF_2	21	16.9	EGF-like domain
4	PF01344 Kelch_1	4.5e-23	91.9	Kelch motif
5	PF07646 Kelch_2	3.1e-07	41.4	Kelch motif
6	PF13415 Kelch_3	9.3e-10	49.8	Galactose oxidase, central domain
7	PF13418 Kelch_4	2.8e-10	51.3	Galactose oxidase, central domain
8	PF13854 Kelch_5	2.6e-11	54.4	Kelch motif
9	PF13964 Kelch_6	5.6e-16	69.4	Kelch motif
10	PF00053 Laminin_EGF	5.5	18.5	Laminin EGF domain
11	PF00059 Lectin_C	3.5e-12	58.4	Lectin C-type domain
12	PF01437 PSI	3.1e-13	61.4	Plexin repeat
13	PF17205 PSI_integrin	20	16.3	Integrin plexin domain
14	PF16311 TMEM100	57	14.8	Transmembrane protein 100

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262919

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262370	0.987	E3 ubiquitin-protein ligase MGRN1
2	9606.ENSP00000454804	0.861	Agouti-signaling protein
3	9606.ENSP00000299766	0.799	Melanocortin receptor 4
4	9606.ENSP00000451605	0.706	Melanocyte-stimulating hormone receptor
5	9606.ENSP00000310832	0.694	Cathepsin F
6	9606.ENSP00000353868	0.689	PC-esterase domain containing 1A
7	9606.ENSP00000342197	0.670	Butyrophilin-like protein 8
8	9606.ENSP00000386104	0.637	Carboxypeptidase E
9	9606.ENSP00000202816	0.629	ESF1 homolog
10	9606.ENSP00000335557	0.627	SLX4 interacting protein
11	9606.ENSP00000353731	0.609	Dipeptidyl peptidase 4
12	9606.ENSP00000269391	0.596	E3 ubiquitin ligase RNF157
13	9606.ENSP00000403925	0.566	Tubulin-specific chaperone cofactor E-like protein
14	9606.ENSP00000314099	0.561	Carbonic anhydrase 5B, mitochondrial
15	9606.ENSP00000318912	0.557	Carbonic anhydrase 13
16	9606.ENSP00000296130	0.537	Tetranectin
17	9606.ENSP00000309649	0.519	Carbonic anhydrase 5A, mitochondrial
18	9606.ENSP00000358107	0.519	Carbonic anhydrase 14
19	9606.ENSP00000314407	0.510	Carbonic anhydrase-related protein
20	9606.ENSP00000345659	0.505	Carbonic anhydrase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.995	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.971	biological regulation
GO:0050896	0.935	response to stimulus
GO:0009987	0.929	cellular process
GO:0050789	0.917	regulation of biological process
GO:0043473	0.806	pigmentation
GO:0050794	0.717	regulation of cellular process
GO:0032501	0.360	multicellular organismal process
GO:0032502	0.353	developmental process
GO:0048856	0.332	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.993	cytoplasm
GO:0005576	0.990	extracellular region
GO:0043227	0.990	membrane-bounded organelle
GO:0031982	0.952	vesicle
GO:0005615	0.940	extracellular space
GO:0070062	0.915	extracellular exosome
GO:0043231	0.748	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]