StarFunc result for job id O75896

User Input

>input (110 residues)
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLA
HEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75896	1.000	1.000	9.156E-18	110	1.000	1.000	O75896.pdb.gz	TUSC2_HUMAN Tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=TUSC2 PE=1 SV=3
2	AFDB:Q9NU53	0.150	0.061	9.116E-1	330	0.191	0.064	Q9NU53.pdb.gz	GINM1_HUMAN Glycoprotein integral membrane protein 1 OS=Homo sapiens OX=9606 GN=GINM1 PE=1 SV=1
3	PDB:3k8aB	0.174	0.184	1.005	103	0.100	0.107	3k8aB.pdb.gz
4	AFDB:A0A5F9ZH18	0.119	0.025	2.195	1109	0.109	0.011	A0A5F9ZH18.pdb.gz	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
5	AFDB:P16180	0.177	0.150	2.195	149	0.182	0.134	P16180.pdb.gz	RR17_ARATH Small ribosomal subunit protein uS17c OS=Arabidopsis thaliana OX=3702 GN=RPS17 PE=1 SV=1
6	AFDB:P9WH51	0.167	0.149	2.195	135	0.127	0.104	P9WH51.pdb.gz	RS17_MYCTU Small ribosomal subunit protein uS17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpsQ PE=1 SV=1
7	AFDB:Q8ST83	0.197	0.053	2.195	520	0.091	0.019	Q8ST83.pdb.gz	PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster OX=7227 GN=pho PE=1 SV=2
8	AFDB:Q9VCH5	0.208	0.019	2.328	1960	0.127	0.007	Q9VCH5.pdb.gz	NUP98_DROME Nuclear pore complex protein Nup98-Nup96 OS=Drosophila melanogaster OX=7227 GN=Nup98-96 PE=1 SV=3
9	AFDB:Q63665	0.196	0.071	2.468	346	0.145	0.046	Q63665.pdb.gz	USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus OX=10116 GN=Usf2 PE=1 SV=2
10	PDB:5ndvS6	0.194	0.123	2.566	200	0.100	0.055	5ndvS6.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
11	PDB:6hgoC	0.137	0.123	2.721	127	0.073	0.063	6hgoC.pdb.gz
12	AFDB:A0A140LGL2	0.193	0.174	2.943	128	0.173	0.148	A0A140LGL2.pdb.gz
13	AFDB:Q5A7R7	0.208	0.057	2.943	511	0.109	0.023	Q5A7R7.pdb.gz	IFF11_CANAL Cell wall protein IFF11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF11 PE=1 SV=1
14	PDB:3bw1A	0.107	0.113	3.059	86	0.082	0.105	3bw1A.pdb.gz
15	PDB:1qttA	0.186	0.177	3.244	117	0.064	0.060	1qttA.pdb.gz
16	PDB:5ondA	0.147	0.128	3.439	135	0.073	0.059	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
17	PDB:4tllA	0.150	0.031	3.647	767	0.064	0.009	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
18	PDB:2eyqA	0.186	0.023	3.867	1146	0.064	0.006	2eyqA.pdb.gz
19	PDB:4o9yA	0.113	0.011	3.867	2490	0.073	0.003	4o9yA.pdb.gz
20	PDB:6o9lQ	0.130	0.055	3.867	430	0.136	0.035	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75896	9.19e-78	226	110	1.000	1.000	TUSC2_HUMAN Tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=TUSC2 PE=1 SV=3
2	Q9WVF8	4.92e-65	194	110	0.927	0.927	TUSC2_MOUSE Tumor suppressor candidate 2 OS=Mus musculus OX=10090 GN=Tusc2 PE=1 SV=3
3	M9RSF4	0.43	31.6	487	0.218	0.049	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
4	Q92985	0.64	31.2	503	0.218	0.048	IRF7_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=2
5	J3KSZ7	1.3	30.0	379	0.182	0.053	J3KSZ7_HUMAN Septin OS=Homo sapiens OX=9606 GN=SEPTIN4 PE=1 SV=1
6	Q9VKD6	1.5	30.0	231	0.155	0.074	DGT2_DROME Augmin complex subunit dgt2 OS=Drosophila melanogaster OX=7227 GN=dgt2 PE=1 SV=1
7	P28661	1.9	29.6	478	0.182	0.042	SEPT4_MOUSE Septin-4 OS=Mus musculus OX=10090 GN=Septin4 PE=1 SV=1
8	O43236	2.1	29.6	478	0.182	0.042	SEPT4_HUMAN Septin-4 OS=Homo sapiens OX=9606 GN=SEPTIN4 PE=1 SV=1
9	Q9HB64	2.3	28.9	128	0.191	0.164	Q9HB64_HUMAN Interferon regulatory factor-7H (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
10	E7ESY0	4.0	28.9	748	0.118	0.017	E7ESY0_HUMAN phosphoinositide 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=2
11	P03523	4.8	28.9	2109	0.109	0.006	L_VSIVA RNA-directed RNA polymerase L OS=Vesicular stomatitis Indiana virus (strain San Juan) OX=11285 GN=L PE=1 SV=2
12	Q9FZ21	6.9	28.1	329	0.136	0.046	G2OX6_ARATH Gibberellin 2-beta-dioxygenase 6 OS=Arabidopsis thaliana OX=3702 GN=GA2OX6 PE=2 SV=1
13	Q960X3	8.8	27.7	514	0.145	0.031	Q960X3_DROME LD31354p OS=Drosophila melanogaster OX=7227 GN=kon PE=2 SV=1
14	A3RLX3	9.5	27.7	2381	0.145	0.007	A3RLX3_DROME Kon-tiki OS=Drosophila melanogaster OX=7227 GN=Kon PE=1 SV=1
15	Q9VJ82	9.5	27.7	2381	0.145	0.007	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15000 TUSC2	3.3e-39	145.0	Tumour suppressor candidate 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.768	Suppressor of fused homolog
2	9606.ENSP00000351642	0.690	Belongs to the cappuccino family
3	9606.ENSP00000336666	0.688	AP-1 complex subunit sigma-1A
4	9606.ENSP00000289081	0.650	Fanconi anemia group C protein
5	9606.ENSP00000432104	0.650	Endogenous Bornavirus-like nucleoprotein 2
6	9606.ENSP00000473842	0.577	Endogenous Bornavirus-like nucleoprotein 1
7	9606.ENSP00000377934	0.576	Kinesin-like protein KIF7
8	9606.ENSP00000297814	0.571	Kinesin-like protein KIF27
9	9606.ENSP00000350716	0.548	Tumor suppressor candidate 1
10	9606.ENSP00000232501	0.527	GATOR complex protein NPRL2
11	9606.ENSP00000011473	0.514	Synaptophysin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0010605	0.975	negative regulation of macromolecule metabolic process
GO:0006950	0.974	response to stress
GO:0032502	0.972	developmental process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0032501	0.967	multicellular organismal process
GO:0010468	0.967	regulation of gene expression
GO:0051179	0.954	localization
GO:0065008	0.950	regulation of biological quality
GO:0002376	0.945	immune system process
GO:0009607	0.942	response to biotic stimulus
GO:0009605	0.935	response to external stimulus
GO:0001817	0.918	regulation of cytokine production
GO:0044419	0.917	biological process involved in interspecies interaction between organisms
GO:0006952	0.896	defense response
GO:0051707	0.895	response to other organism
GO:0032653	0.887	regulation of interleukin-10 production
GO:0002252	0.873	immune effector process
GO:0001906	0.865	cell killing
GO:0051873	0.865	killing by host of symbiont cells
GO:0001775	0.850	cell activation
GO:0002444	0.836	myeloid leukocyte mediated immunity
GO:0051240	0.832	positive regulation of multicellular organismal process
GO:0010628	0.826	positive regulation of gene expression
GO:0048856	0.803	anatomical structure development
GO:0001819	0.765	positive regulation of cytokine production
GO:0051234	0.689	establishment of localization
GO:0032733	0.679	positive regulation of interleukin-10 production
GO:0006810	0.606	transport
GO:0030154	0.573	cell differentiation
GO:0048468	0.457	cell development
GO:0042391	0.429	regulation of membrane potential
GO:0051881	0.422	regulation of mitochondrial membrane potential
GO:0045321	0.416	leukocyte activation
GO:0001909	0.415	leukocyte mediated cytotoxicity
GO:2000377	0.411	regulation of reactive oxygen species metabolic process
GO:0021700	0.409	developmental maturation
GO:0016192	0.384	vesicle-mediated transport
GO:0080090	0.328	regulation of primary metabolic process
GO:0051171	0.318	regulation of nitrogen compound metabolic process
GO:0010629	0.310	negative regulation of gene expression
GO:0006954	0.301	inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.989	mitochondrion
GO:0005829	0.359	cytosol
GO:0071944	0.328	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]