StarFunc result for job id O75899

User Input

>input (941 residues)
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75899	1.000	1.000	0.000	941	1.000	1.000	O75899.pdb.gz	GABR2_HUMAN Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens OX=9606 GN=GABBR2 PE=1 SV=1
2	PDB:6w2xB	0.660	0.910	6.067E-88	669	0.710	0.999	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
3	AFDB:A0A0B4LHR4	0.705	0.549	1.937E-72	1224	0.369	0.283	A0A0B4LHR4.pdb.gz	A0A0B4LHR4_DROME Metabotropic GABA-B receptor subtype 2, isoform C OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
4	AFDB:Q9V3Q9	0.711	0.792	3.313E-67	841	0.291	0.326	Q9V3Q9.pdb.gz	Q9V3Q9_DROME IP03705p OS=Drosophila melanogaster OX=7227 GN=GABA-B-R1 PE=2 SV=3
5	AFDB:F1QAJ3	0.712	0.677	3.638E-67	993	0.299	0.283	F1QAJ3.pdb.gz	F1QAJ3_DANRE Gamma-aminobutyric acid (GABA) B receptor, 1b OS=Danio rerio OX=7955 GN=gabbr1b PE=3 SV=2
6	AFDB:G5ECB2	0.692	0.769	2.985E-65	842	0.292	0.327	G5ECB2.pdb.gz	GABR2_CAEEL Gamma-aminobutyric acid type B receptor subunit 2 OS=Caenorhabditis elegans OX=6239 GN=gbb-2 PE=1 SV=1
7	AFDB:Q9Z0U4	0.721	0.686	1.218E-64	991	0.290	0.275	Q9Z0U4.pdb.gz	GABR1_RAT Gamma-aminobutyric acid type B receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Gabbr1 PE=1 SV=1
8	AFDB:H9FSF4	0.698	0.684	1.773E-64	961	0.291	0.285	H9FSF4.pdb.gz	H9FSF4_MACMU Gamma-aminobutyric acid type B receptor subunit 1 isoform a OS=Macaca mulatta OX=9544 GN=GABBR1 PE=2 SV=1
9	AFDB:H2L0Q3	0.687	0.718	8.551E-60	899	0.248	0.259	H2L0Q3.pdb.gz	GABR1_CAEEL Gamma-aminobutyric acid type B receptor subunit 1 OS=Caenorhabditis elegans OX=6239 GN=gbb-1 PE=1 SV=2
10	PDB:7c7sA	0.638	0.855	3.068E-56	685	0.261	0.359	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
11	AFDB:Q54ET0	0.335	0.381	5.465E-37	816	0.170	0.196	Q54ET0.pdb.gz	GRLE_DICDI Metabotropic glutamate receptor-like protein E OS=Dictyostelium discoideum OX=44689 GN=grlE PE=2 SV=2
12	AFDB:A1Z7F5	0.337	0.260	1.188E-32	1248	0.183	0.138	A1Z7F5.pdb.gz	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
13	PDB:7e9hR	0.326	0.369	1.992E-27	766	0.151	0.185	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
14	PDB:7e9gR	0.330	0.382	3.479E-26	769	0.136	0.166	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
15	PDB:7epaA	0.343	0.407	2.366E-24	782	0.132	0.159	7epaA.pdb.gz
16	PDB:7wihA	0.328	0.404	2.034E-22	741	0.140	0.178	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
17	PDB:7epcA	0.345	0.409	2.454E-22	782	0.150	0.180	7epcA.pdb.gz
18	PDB:7dtvA	0.326	0.386	5.389E-20	779	0.143	0.173	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
19	PDB:4pe5C	0.320	0.393	3.151E-16	754	0.072	0.090	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
20	PDB:4tllA	0.318	0.384	7.291E-15	767	0.068	0.083	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LHR4	0.0	622	1224	0.358	0.275	A0A0B4LHR4_DROME Metabotropic GABA-B receptor subtype 2, isoform C OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
2	O75899	0.0	1959	941	1.000	1.000	GABR2_HUMAN Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens OX=9606 GN=GABBR2 PE=1 SV=1
3	O88871	0.0	1912	940	0.977	0.978	GABR2_RAT Gamma-aminobutyric acid type B receptor subunit 2 OS=Rattus norvegicus OX=10116 GN=Gabbr2 PE=1 SV=2
4	Q80T41	0.0	1918	940	0.980	0.981	GABR2_MOUSE Gamma-aminobutyric acid type B receptor subunit 2 OS=Mus musculus OX=10090 GN=Gabbr2 PE=1 SV=2
5	Q8IN24	0.0	628	1220	0.358	0.276	Q8IN24_DROME Metabotropic GABA-B receptor subtype 2, isoform A OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
6	Q9BML6	0.0	628	1220	0.358	0.276	Q9BML6_DROME Metabotropic GABA-B receptor subtype 2 OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=1 SV=1
7	Q9Y133	0.0	628	1221	0.358	0.276	Q9Y133_DROME BcDNA.GH07312 OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=2 SV=1
8	Q9V3Q9	1.09e-161	497	841	0.293	0.328	Q9V3Q9_DROME IP03705p OS=Drosophila melanogaster OX=7227 GN=GABA-B-R1 PE=2 SV=3
9	G5ECB2	2.86e-153	475	842	0.274	0.306	GABR2_CAEEL Gamma-aminobutyric acid type B receptor subunit 2 OS=Caenorhabditis elegans OX=6239 GN=gbb-2 PE=1 SV=1
10	F1QAJ3	1.12e-150	473	993	0.279	0.265	F1QAJ3_DANRE Gamma-aminobutyric acid (GABA) B receptor, 1b OS=Danio rerio OX=7955 GN=gabbr1b PE=3 SV=2
11	Q9WV18	5.20e-149	467	960	0.284	0.278	GABR1_MOUSE Gamma-aminobutyric acid type B receptor subunit 1 OS=Mus musculus OX=10090 GN=Gabbr1 PE=1 SV=1
12	Q9UBS5	9.95e-149	467	961	0.284	0.278	GABR1_HUMAN Gamma-aminobutyric acid type B receptor subunit 1 OS=Homo sapiens OX=9606 GN=GABBR1 PE=1 SV=1
13	H9FSF4	1.20e-148	466	961	0.284	0.278	H9FSF4_MACMU Gamma-aminobutyric acid type B receptor subunit 1 isoform a OS=Macaca mulatta OX=9544 GN=GABBR1 PE=2 SV=1
14	Q9Z0U4	8.81e-143	452	991	0.284	0.269	GABR1_RAT Gamma-aminobutyric acid type B receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Gabbr1 PE=1 SV=1
15	Q9BML5	3.27e-118	393	1305	0.251	0.181	Q9BML5_DROME Putative metabotropic GABA-B receptor subtype 3 OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=2 SV=1
16	Q9VPS7	3.62e-118	393	1305	0.253	0.182	Q9VPS7_DROME Metabotropic GABA-B receptor subtype 3, isoform A OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=1 SV=2
17	H2L0Q3	1.29e-112	369	899	0.248	0.259	GABR1_CAEEL Gamma-aminobutyric acid type B receptor subunit 1 OS=Caenorhabditis elegans OX=6239 GN=gbb-1 PE=1 SV=2
18	Q8MSP9	1.08e-71	246	458	0.148	0.303	Q8MSP9_DROME AT01906p OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=2 SV=1
19	Q058U9	4.72e-53	199	650	0.148	0.214	Q058U9_DROME IP15483p OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=2 SV=1
20	X2J962	1.00e-39	155	450	0.094	0.196	X2J962_DROME Metabotropic GABA-B receptor subtype 3, isoform H OS=Drosophila melanogaster OX=7227 GN=GABA-B-R3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	8.9e-64	227.2	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF01094 ANF_receptor	2.2e-48	176.8	Receptor family ligand binding region
3	PF00689 Cation_ATPase_C	23	16.2	Cation transporting ATPase, C-terminus
4	PF05667 CCDC22	4.2e+02	11.1	Coiled-coil domain-containing protein 22
5	PF11770 GAPT	83	14.4	GRB2-binding adapter (GAPT)
6	PF18455 GBR2_CC	1.2e-24	97.2	Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain
7	PF05622 HOOK	8.8e+02	10.0	HOOK protein coiled-coil region
8	PF13458 Peripla_BP_6	2.3e-09	49.1	Periplasmic binding protein
9	PF06785 UPF0242	1.7e+02	13.7	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007251

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004333	0.997	Gamma-aminobutyric acid (GABA) B receptor, 1
2	60711.ENSCSAP00000017522	0.938	Uncharacterized protein
3	60711.ENSCSAP00000004726	0.885	Potassium inwardly-rectifying channel, subfamily J, member 6
4	60711.ENSCSAP00000001466	0.871	G protein subunit alpha o1
5	60711.ENSCSAP00000007704	0.859	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
6	60711.ENSCSAP00000015529	0.852	Potassium inwardly-rectifying channel, subfamily J, member 9
7	60711.ENSCSAP00000003391	0.850	G protein-coupled receptor 156
8	60711.ENSCSAP00000008065	0.848	G protein subunit alpha i1
9	60711.ENSCSAP00000016477	0.848	G protein subunit alpha i3
10	60711.ENSCSAP00000012046	0.847	Potassium inwardly-rectifying channel, subfamily J, member 3
11	60711.ENSCSAP00000010462	0.846	G protein subunit alpha i2
12	60711.ENSCSAP00000007586	0.829	G protein subunit beta 5
13	60711.ENSCSAP00000015802	0.814	Potassium inwardly-rectifying channel, subfamily J, member 5
14	60711.ENSCSAP00000017306	0.801	G protein subunit beta 1
15	60711.ENSCSAP00000013954	0.799	G protein subunit beta 2
16	60711.ENSCSAP00000011177	0.798	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
17	60711.ENSCSAP00000008394	0.794	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
18	60711.ENSCSAP00000015002	0.787	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
19	60711.ENSCSAP00000009172	0.786	G protein subunit beta 4
20	60711.ENSCSAP00000006464	0.785	G protein subunit beta 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016917	1.000	GABA receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0004965	0.984	G protein-coupled GABA receptor activity
GO:0046982	0.959	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0007154	0.998	cell communication
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.993	cellular response to stimulus
GO:0023052	0.988	signaling
GO:0007193	0.968	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007214	0.928	gamma-aminobutyric acid signaling pathway
GO:0065009	0.623	regulation of molecular function
GO:0050790	0.535	regulation of catalytic activity
GO:0099536	0.369	synaptic signaling
GO:0032501	0.347	multicellular organismal process
GO:0007268	0.346	chemical synaptic transmission
GO:0042221	0.332	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098796	0.998	membrane protein complex
GO:0098797	0.993	plasma membrane protein complex
GO:0098802	0.979	plasma membrane signaling receptor complex
GO:1902710	0.977	GABA receptor complex
GO:0097648	0.972	G protein-coupled receptor complex
GO:0005622	0.915	intracellular anatomical structure
GO:0005737	0.829	cytoplasm
GO:0038037	0.478	G protein-coupled receptor dimeric complex
GO:1902712	0.454	G protein-coupled GABA receptor complex
GO:0030054	0.426	cell junction
GO:0038039	0.385	G protein-coupled receptor heterodimeric complex
GO:0045202	0.358	synapse
GO:0042995	0.352	cell projection
GO:0098794	0.343	postsynapse
GO:0098793	0.341	presynapse
GO:0098590	0.331	plasma membrane region
GO:0120025	0.318	plasma membrane bounded cell projection
GO:0042734	0.317	presynaptic membrane
GO:0043226	0.316	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]